Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: solha-e0ycs2

Lycopersicon hirsutum f. glabratum Methylketone synthase I mks1

Relationship
Family|Hydroxynitrile_lyase
Block| X
Position in NCBI Life Tree|Lycopersicon hirsutum f. glabratum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Solanoideae: N E > Solaneae: N E > Solanum: N E > Lycopersicon: N E > Solanum habrochaites: N E > Lycopersicon hirsutum f. glabratum: N E


Molecular evidence
Database
No mutation
6 structures (e.g. : 3STT, 3STU, 3STV... more)
No kinetic





3 substrates: 3-Oxoheptanoic-acid, 3-ketomyristate, Methyl-3-oxotetradecanoate
4 inhibitors (e.g. : 2-Tridecanone, 3-hydroxyoctanoate, Decanoate... more)
2 Genbank : AY701574, GU987105
2 UniProt : Q56S61, E0YCS2
>3 Structure links 3 more: 3STT, 3STU, 3STV
1 UniProt : Q56S61
1 Interpro : Q56S61
1 Prodom : Q56S61
1 Pfam : Q56S61
1 PIRSF : Q56S61
1 SUPERFAM : Q56S61
Sequence
Graphical view for this peptide sequence: solha-e0ycs2
Colored MSA for Hydroxynitrile_lyase (raw)
MEKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGI
NPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETF
PEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPP
TTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSK
RYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKP
QQLFTTLLSIANKYK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGI
NPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETF
PEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPP
TTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSK
RYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKP
QQLFTTLLSIANKYK


References
    Title: Emergent decarboxylase activity and attenuation of alpha/beta-hydrolase activity during the evolution of methylketone biosynthesis in tomato
    Auldridge ME, Guo Y, Austin MB, Ramsey J, Fridman E, Pichersky E, Noel JP
    Ref: Plant Cell, 24:1596, 2012 : PubMed

            

    Title: Enzymatic functions of wild tomato methylketone synthases 1 and 2
    Yu G, Nguyen TT, Guo Y, Schauvinhold I, Auldridge ME, Bhuiyan N, Ben-Israel I, Iijima Y, Fridman E and Pichersky E <1 more author(s)>
    Ref: Plant Physiol, 154:67, 2010 : PubMed

            

    Title: Metabolic, genomic, and biochemical analyses of glandular trichomes from the wild tomato species Lycopersicon hirsutum identify a key enzyme in the biosynthesis of methylketones
    Fridman E, Wang J, Iijima Y, Froehlich JE, Gang DR, Ohlrogge J, Pichersky E
    Ref: Plant Cell, 17:1252, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer