Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: spolt-ACHE2

Spodoptera litura (Asian cotton leafworm); Spodoptera frugiperda (Fall armyworm); Spodoptera exigua (Beet armyworm) (Noctua fulgens) acetylcholinesterase 2

Comment
Other strains: Spodoptera litura (Asian cotton leafworm); Spodoptera frugiperda (Fall armyworm); Spodoptera exigua (Beet armyworm) (Noctua fulgens)


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Spodoptera litura
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Amphipyrinae: N E > Spodoptera: N E > Spodoptera litura: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AQQ79919, KY130419, MK138519
1 UniProt : A0A1S5YCX9
2 UniProt : A0A1S5YCX9, A0A2H1VS32
2 Interpro : A0A1S5YCX9, A0A2H1VS32
2 Prodom : A0A1S5YCX9, A0A2H1VS32
2 Pfam : A0A1S5YCX9, A0A2H1VS32
2 PIRSF : A0A1S5YCX9, A0A2H1VS32
2 SUPERFAM : A0A1S5YCX9, A0A2H1VS32
Sequence
Graphical view for this peptide sequence: spolt-ACHE2
Colored MSA for ACHE (raw)
MISNTKIVFTKLLLCCIVSGAWTRSWANHHDTTTSTTQTTPTTSQAPKNF
HNDPLIVETKSGLVKGYAKTVMGREVHIFTGIPFAKPPLGPLRFRKPVPI
DPWHGVLEATAMPNSCYQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWV
PQHLRVRHHQDKPLTERPKVPILVWIYGGGYMSGTATLDLYKADIMASSS
DVIVASMQYRVGAFGFLYLNKYFSPGSEEAPGNMGLWDQQLAIRWIKDNA
RAFGGDPELITLFGESAGGGSVSLHMLSPEMKGLFKRGILQSGTLNAPWS
WMTGERAQDIGKVLVDDCNCNSSLLAADPSLVMDCMRGVDAKTISVQQWN
SYTGILGFPSAPTVDGVFLPKDPDTMMKEGHFHNTEVLLGSNQDEGTYFL
LYDFLDYFEKDGPSFLQREKFLEIVDTIFKDFSKIKREAIVFQYTDWEEI
TDGYLNQKMIADVVGDYFFVCPTNYFAEVLADSGVEVYYYYFTHRTSTSL
WGEWMGVMHGDEMEYVFGHPLNMSLQYHTRERDLAAHIMQSFTRFALTGK
PHKPDEKWPLYSRSSPHYYTYTADGTSGPAGPRGPRASACAFWNDFLNKL
NELEHMPCDGAVTGPYSSVAGTTLPIVLLTTLATTVAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MISNTKIVFTKLLLCCIVSGAWTRSWANHHDTTTSTTQTTPTTSQAPKNF
HNDPLIVETKSGLVKGYAKTVMGREVHIFTGIPFAKPPLGPLRFRKPVPI
DPWHGVLEATAMPNSCYQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWV
PQHLRVRHHQDKPLTERPKVPILVWIYGGGYMSGTATLDLYKADIMASSS
DVIVASMQYRVGAFGFLYLNKYFSPGSEEAPGNMGLWDQQLAIRWIKDNA
RAFGGDPELITLFGESAGGGSVSLHMLSPEMKGLFKRGILQSGTLNAPWS
WMTGERAQDIGKVLVDDCNCNSSLLAADPSLVMDCMRGVDAKTISVQQWN
SYTGILGFPSAPTVDGVFLPKDPDTMMKEGHFHNTEVLLGSNQDEGTYFL
LYDFLDYFEKDGPSFLQREKFLEIVDTIFKDFSKIKREAIVFQYTDWEEI
TDGYLNQKMIADVVGDYFFVCPTNYFAEVLADSGVEVYYYYFTHRTSTSL
WGEWMGVMHGDEMEYVFGHPLNMSLQYHTRERDLAAHIMQSFTRFALTGK
PHKPDEKWPLYSRSSPHYYTYTADGTSGPAGPRGPRASACAFWNDFLNKL
NELEHMPCDGAVTGPYSSVAGTTLPIVLLTTLATTVAL


References
    Title: Whole-genome sequencing to detect mutations associated with resistance to insecticides and Bt proteins in Spodoptera frugiperda
    Guan F, Zhang J, Shen H, Wang X, Padovan A, Walsh TK, Tay WT, Gordon KHJ, James W and Wu Y <3 more author(s)>
    Ref: Insect Sci, 28:627, 2021 : PubMed

            

    Title: Molecular and functional properties of two Spodoptera exigua acetylcholinesterase genes
    Zhao J, Hao D, Xiao L, Tan Y, Jiang Y, Bai L, Wang K
    Ref: Archives of Insect Biochemistry & Physiology, :e21554, 2019 : PubMed

            

    Title: Cloning, expression, and functional analysis of two acetylcholinesterase genes in Spodoptera litura (Lepidoptera: Noctuidae)
    Salim AM, Shakeel M, Ji J, Kang T, Zhang Y, Ali E, Xiao Z, Lu Y, Wan H, Li J
    Ref: Comparative Biochemistry & Physiology B Biochem Mol Biol, 206:16, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer