Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strbi-q5sfd4

Streptomyces bikiniensis putative thioesterase teii family

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces bikiniensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces bikiniensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY509120
1 UniProt : Q5SFD4
1 UniProt : Q5SFD4
1 Interpro : Q5SFD4
1 Prodom : Q5SFD4
1 Pfam : Q5SFD4
1 PIRSF : Q5SFD4
1 SUPERFAM : Q5SFD4
Sequence
Graphical view for this peptide sequence: strbi-q5sfd4
Colored MSA for Thioesterase (raw)
MNEGPATTAPGSTNAGDLWLRRYRPVADPALRLVCLPHAGGSASAFLPFT
CLLPDRVEVLAVQYPGRQDRRLEPFVDSVDALVTHVAGALGPWLDRPVAL
FGHSLGSLVAFETARRLAEQAPESRLAHLFVSGRVAPTVAHRTTAHLLSD
DRLVAKLAELQGTDPRVLADEEVLRMALPAIRNDYRAAATYTWRPGAPLA
CPITVLTGSADPHVPTDGALAWHGLTTGETAFRSFPGGHFYLTEQAEAVC
RTIRTATGLAVGRPHPSSSAAAPYDRESVHDV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNEGPATTAPGSTNAGDLWLRRYRPVADPALRLVCLPHAGGSASAFLPFT
CLLPDRVEVLAVQYPGRQDRRLEPFVDSVDALVTHVAGALGPWLDRPVAL
FGHSLGSLVAFETARRLAEQAPESRLAHLFVSGRVAPTVAHRTTAHLLSD
DRLVAKLAELQGTDPRVLADEEVLRMALPAIRNDYRAAATYTWRPGAPLA
CPITVLTGSADPHVPTDGALAWHGLTTGETAFRSFPGGHFYLTEQAEAVC
RTIRTATGLAVGRPHPSSSAAAPYDRESVHDV


Reference
    Title: Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae
    Ward SL, Hu Z, Schirmer A, Reid R, Revill WP, Reeves CD, Petrakovsky OV, Dong SD, Katz L
    Ref: Antimicrobial Agents & Chemotherapy, 48:4703, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer