Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strhy-O30482

Streptomyces hygroscopicus pks module 4 Thioesterase domain

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces hygroscopicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces hygroscopicus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF007101
1 UniProt : O30482
1 Interpro : O30482
1 Prodom : O30482
1 Pfam : O30482
1 PIRSF : O30482
1 SUPERFAM : O30482
Sequence
Graphical view for this peptide sequence: strhy-O30482
Colored MSA for Thioesterase (raw)
RVVCVPAVTPAATPHEYDALGRRLDGVLASAVLPYPGFGAGQAMPEDRRT
LVGMHARSVLDHVGDEPYVLVGRSLGGTVAHAVTSELERLGRGPRGLVLI
DTYPLDASRAQEWLLGLPARAAVEEGAPDDAALLAMGAYLRAFADWTRYA
VTTPPLFLRPGRPTPAMPRKDGWQATWPLPHDLIEVAGDHFTVLTDEVAD
TAEALLGWLEKLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RVVCVPAVTPAATPHEYDALGRRLDGVLASAVLPYPGFGAGQAMPEDRRT
LVGMHARSVLDHVGDEPYVLVGRSLGGTVAHAVTSELERLGRGPRGLVLI
DTYPLDASRAQEWLLGLPARAAVEEGAPDDAALLAMGAYLRAFADWTRYA
VTTPPLFLRPGRPTPAMPRKDGWQATWPLPHDLIEVAGDHFTVLTDEVAD
TAEALLGWLEKLD


Reference
    Title: A second type-I PKS gene cluster isolated from Streptomyces hygroscopicus ATCC 29253, a rapamycin-producing strain
    Ruan X, Stassi D, Lax SA, Katz L
    Ref: Gene, 203:1, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer