Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strsc-a0a100jmt3

Streptomyces scabiei. Extracellular exo-alpha-L-arabinofuranosidase

Comment
n-term Ricin_B_lectin excluded. Other strains: Streptomyces scabiei (strain 87.22)


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Streptomyces scabiei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces scabiei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BCMM01000011, FN554889
2 UniProt : A0A100JMT3, C9ZE96
2 UniProt : A0A100JMT3, C9ZE96
2 Interpro : A0A100JMT3, C9ZE96
2 Prodom : A0A100JMT3, C9ZE96
2 Pfam : A0A100JMT3, C9ZE96
2 PIRSF : A0A100JMT3, C9ZE96
2 SUPERFAM : A0A100JMT3, C9ZE96
Sequence
Graphical view for this peptide sequence: strsc-a0a100jmt3
Colored MSA for FaeC (raw)
GGCGNAPTLASGTHTIQSGGKSRSFILRVPANYDNSRPYRLIFAFHWRGG
TAGDVASGGTSGSAWSYYGQQEQSDNSAILVAPQGLGNGWGNAGGEDVTF
VDDMIRRIEGGLCVNPAQRFATGFSWGGGMSYALACSRANVFRAVAVISG
AQISGCDGGSQPIAYLGIHGVGDSVLNIGQGRSLRDKFVGNNGCTPQSPR
EPAPGSRTHITTAYAGCRAGYPVQWAAFDGGHMPGPVDGSSGESGVTTWT
KAEIWRFFAQFS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GGCGNAPTLASGTHTIQSGGKSRSFILRVPANYDNSRPYRLIFAFHWRGG
TAGDVASGGTSGSAWSYYGQQEQSDNSAILVAPQGLGNGWGNAGGEDVTF
VDDMIRRIEGGLCVNPAQRFATGFSWGGGMSYALACSRANVFRAVAVISG
AQISGCDGGSQPIAYLGIHGVGDSVLNIGQGRSLRDKFVGNNGCTPQSPR
EPAPGSRTHITTAYAGCRAGYPVQWAAFDGGHMPGPVDGSSGESGVTTWT
KAEIWRFFAQFS


References
    Title: Draft Genome Sequences of Streptomyces scabiei S58, Streptomyces turgidiscabies T45, and Streptomyces acidiscabies a10, the Pathogens of Potato Common Scab, Isolated in Japan
    Tomihama T, Nishi Y, Sakai M, Ikenaga M, Okubo T, Ikeda S
    Ref: Genome Announc, 4:e00062, 2016 : PubMed

            

    Title: Streptomyces scabies 87-22 contains a coronafacic acid-like biosynthetic cluster that contributes to plant-microbe interactions
    Bignell DR, Seipke RF, Huguet-Tapia JC, Chambers AH, Parry RJ, Loria R
    Ref: Mol Plant Microbe Interact, 23:161, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer