Gene_locus Report for: strsw-c9zdz9Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative secreted protein Comment only c-term Pfam A Abhydrolase_8 157 331 Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces scabiei: N E
6_AlphaBeta_hydrolase : strsw-c9ysy6Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein, strsw-c9ysy7Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein, strsw-c9ysz9Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein, strsw-c9yzy1Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein, strsw-c9z724Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative hydrolase, strsw-c9zb72Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative hydrolase, strsw-c9zg72Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein. A85-Est-Putative : strsw-c9z0t6Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative membrane protein. A85-Mycolyl-transferase : strsw-c9yxp5Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative secreted esterase, strsw-c9zcs0Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative sugar/fatty acid transferase. Acetyl-esterase_deacetylase : strsw-c9yyg1Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative esterase. Aclacinomycin-methylesterase_RdmC : strsw-c9yxp4Streptomyces scabies (Streptomyces scabiei); Streptomyces acidiscabies Putative hydrolase, strsw-c9z486Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative hydrolase. Bacterial_Est97 : strsw-c9z6c5Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein. Bacterial_esterase : strsw-c9yz19Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative uncharacterized protein. CarbLipBact_2 : strsw-c9ytw9Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative lipase. Carbon-carbon_bond_hydrolase : strsw-c9zeh4Streptomyces scabies (strain 87.22) (Streptomyces scabiei) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase BphD. Carboxymethylbutenolide_lactonase : strsw-c9z895Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase. Carb_B_Bacteria : strsw-c9yt68Streptomyces scabies (Streptomyces scabiei) Putative carboxylesterase, strsw-c9z4v3Streptomyces scabies (Streptomyces scabiei) Putative carboxylesterase. Cutinase : strsw-c9zcr8Streptomyces scabies (Streptomyces scabiei) secreted esterase sub1 ScSub1. DPP4N_Peptidase_S9 : strsw-c9zby2Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative dipeptidyl-peptidase IV. Duf_1023 : strsw-c9z6e8Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative secreted protein, strsw-c9z427Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative secreted protein. Epoxide_hydrolase : strsw-c9z3u6Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Streptomyces sp. Mg1 Putative hydrolase, strsw-c9z3z0Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative hydrolase, strsw-c9zb30Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative hydrolase, strsw-c9zc13Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative oxidoreductase. Fungal-Bact_LIP : strsw-c9z9y4Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative secreted protein. Haloperoxidase : strsw-c9yt44Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Non-heme haloperoxidase, strsw-c9yu91Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Non-heme chloroperoxidase. Lipase_2 : strsw-c9zcj5Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative secreted lipase. Monoglyceridelipase_lysophospholip : strsw-c9z6l3Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative lipase. Peptidase_S37 : strsw-c9z498Streptomyces scabies (Streptomyces scabiei); Streptomyces sp. Putative secreted tripeptidyl aminopeptidase. Proline_iminopeptidase : strsw-c9ywr2Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Proline iminopeptidase, strsw-c9z1u3Streptomyces scabies (strain 87.22) (Streptomyces scabiei). Putative prolyl aminopeptidase. RsbQ-like : strsw-c9yvs3Streptomyces scabies (strain 87.22) (Streptomyces scabiei) Putative hydrolase
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: strsw-c9zdz9 Colored MSA for Duf_1023 (raw)
TRMHDQRLSETGRHEAGRRMHRFAMLAAKKRDILAFDPEGNGRVAEVFGS
LDTAERVSVVVPGVDTSIINFQRTNRRFSAPVGMAESLYDAERSADPATP
TAVIAWADYTAPTGLGLDSATALRAEQGSVRLNALVRSLPVGSTVALVCH
SYGSVVCGVAAPSLPSRVTDIAVAGSPGMRADSVRQLRTGARVWAMRDAD
DWIQDVPYLEVGGLGHGADPVSSEFGARVMSAADARGHSGYFEPGTESLH
NFAEIGIGAYASVRCAREDDSCLAGLSDSAAA
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
TRMHDQRLSETGRHEAGRRMHRFAMLAAKKRDILAFDPEGNGRVAEVFGS LDTAERVSVVVPGVDTSIINFQRTNRRFSAPVGMAESLYDAERSADPATP TAVIAWADYTAPTGLGLDSATALRAEQGSVRLNALVRSLPVGSTVALVCH SYGSVVCGVAAPSLPSRVTDIAVAGSPGMRADSVRQLRTGARVWAMRDAD DWIQDVPYLEVGGLGHGADPVSSEFGARVMSAADARGHSGYFEPGTESLH NFAEIGIGAYASVRCAREDDSCLAGLSDSAAA
|
|
|