Gene_locus Report for: tetts-q247n8

Tetrahymena thermophila SB210 putative serine esterase

Comment

only c-term PfamA DUF676 483 678

Relationship

Family	\|	Duf_676
Block	\|	X
Position in NCBI Life Tree	\|	Tetrahymena thermophila SB210

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Ciliophora: N E > Intramacronucleata: N E > Oligohymenophorea: N E > Hymenostomatida: N E > Tetrahymenina: N E > Tetrahymenidae: N E > Tetrahymena: N E > Tetrahymena thermophila: N E > Tetrahymena thermophila SB210: N E

There are 153 a/b hydrolases in Tetrahymena thermophila SB210 view in a: Table

6_AlphaBeta_hydrolase : tetts-q22bm9Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q22ci5Tetrahymena thermophila SB210 hypothetical protein, tetts-q22ls2Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q22nu5Tetrahymena thermophila SB210 u1 zinc finger family protein, tetts-q22p29Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q22wx3Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q23ml8Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q24fe1Tetrahymena thermophila SB210 hypothetical protein, tetts-q24fe2Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q24fe7Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q229y8Tetrahymena thermophila SB210 hypothetical protein, tetts-q236h8Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein.
A85-EsteraseD-FGH : tetts-q238b1Tetrahymena thermophila SB210 Only c-term PfamA Esterase alcohol dehydrogenase family protein.
ABHD17-depalmitoylase : tetts-q22d15Tetrahymena thermophila SB210 hypothetical protein, tetts-q22wp5Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein.
abh_upf0017 : tetts-q22h28Tetrahymena thermophila SB210 hypothetical protein, tetts-q23c68Tetrahymena thermophila SB210 hypothetical protein.
abh_upf00227 : tetts-I7MG55Tetrahymena thermophila SB210 hypothetical protein, tetts-q22qb8Tetrahymena thermophila SB210 hypothetical protein, tetts-q22qb9Tetrahymena thermophila SB210 hypothetical protein.
Acidic_Lipase : tetts-q22fu9Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q22ke1Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q22lp7Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q22rl6Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q22wb7Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q22z77Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q22z78Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q23fd6Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein, tetts-q23ms8Tetrahymena thermophila SB210 hypothetical protein, tetts-q24i21Tetrahymena thermophila SB210 ab-hydrolase associated lipase region family protein.
ACPH_Peptidase_S9 : tetts-q23ck3Tetrahymena thermophila SB210 prolyl oligopeptidase family protein, tetts-q239b4Tetrahymena thermophila SB210 prolyl oligopeptidase family protein, tetts-q239b5Tetrahymena thermophila SB210 prolyl oligopeptidase family protein.
AlphaBeta_hydrolase : tetts-q22ej8Tetrahymena thermophila SB210 hypothetical protein, tetts-q22ej9Tetrahymena thermophila SB210 hypothetical protein, tetts-q22ek0Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q22el7Tetrahymena thermophila SB210 hypothetical protein, tetts-q23em7Tetrahymena thermophila SB210 hypothetical protein, tetts-q23fz1Tetrahymena thermophila SB210 hypothetical protein, tetts-q23h38Tetrahymena thermophila SB210 hypothetical protein, tetts-q23mt8Tetrahymena thermophila SB210 hypothetical protein, tetts-q23nm7Tetrahymena thermophila SB210 hypothetical protein, tetts-q23yl3Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q24er4Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q230b2

Tetrahymena thermophila SB210 hypothetical protein Entity ID: 21 ATPTT2 in Type III ATP synthase, tetts-q234e4Tetrahymena thermophila SB210 hypothetical protein.
Carboxypeptidase_S10 : tetts-q22ay8Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q22dt8Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q22dt9Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q22f45Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q22f46Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q22kr5Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q22pf3Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q22pf8Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23ih4Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23mi3Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23mi5Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23nm2Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23qv3Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23qw2Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23qw5Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23qx6Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23qx7Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q23qx8Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q234i0Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q239b7Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q239c3Tetrahymena thermophila SB210 serine carboxypeptidase family protein, tetts-q243q3Tetrahymena thermophila SB210 serine carboxypeptidase family protein.
CGI-58_ABHD5_ABHD4 : tetts-a4veu1Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q22kh7Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q23it6Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q23l29Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q23r77Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q24h15Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q230x1Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q230x2Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein.
Dienelactone_hydrolase : tetts-q232i6Tetrahymena thermophila SB210 dienelactone hydrolase family protein, tetts-q249k7Tetrahymena thermophila SB210 dienelactone hydrolase family protein, tetts-q249m3Tetrahymena thermophila SB210 dienelactone hydrolase family protein.
Duf_676 : tetts-q23d68Tetrahymena thermophila SB210 hypothetical protein, tetts-q23pl2Tetrahymena thermophila SB210 hypothetical protein, tetts-q23q06Tetrahymena thermophila SB210 putative serine esterase, tetts-q23qe7Tetrahymena thermophila SB210 serine esterase, putative.
FSH1 : tetts-q23c26Tetrahymena thermophila SB210 hypothetical protein, tetts-q23j33Tetrahymena thermophila SB210 hypothetical protein.
Hormone-sensitive_lipase_like : tetts-q22ef5Tetrahymena thermophila SB210 hypothetical protein, tetts-q22fz2Tetrahymena thermophila SB210 hypothetical protein, tetts-q22t22Tetrahymena thermophila SB210 hypothetical protein, tetts-q24fz7Tetrahymena thermophila SB210 hypothetical protein, tetts-q246g7Tetrahymena thermophila SB210 hypothetical protein.
Lipase_3 : tetts-q22bf3Tetrahymena thermophila SB210 lipase family protein, tetts-q22e19Tetrahymena thermophila SB210 lipase family protein, tetts-q22e20Tetrahymena thermophila SB210 lipase family protein, tetts-q22gn0Tetrahymena thermophila SB210 lipase family protein, tetts-q22sh0Tetrahymena thermophila SB210 lipase family protein, tetts-q23e94Tetrahymena thermophila SB210 lipase family protein, tetts-q23hg6Tetrahymena thermophila SB210 lipase family protein, tetts-q23ig0Tetrahymena thermophila SB210 lipase family protein, tetts-q23k76Tetrahymena thermophila SB210 lipase family protein, tetts-q23k77Tetrahymena thermophila SB210 lipase family protein, tetts-q23kd8Tetrahymena thermophila SB210 lipase family protein, tetts-q23t89Tetrahymena thermophila SB210 lipase family protein, tetts-q24ay2Tetrahymena thermophila SB210 lipase family protein, tetts-q24bp5Tetrahymena thermophila SB210 lipase family protein, tetts-q230u0Tetrahymena thermophila SB210 lipase family protein, tetts-q237r7Tetrahymena thermophila SB210 lipase family protein, tetts-q237s1Tetrahymena thermophila SB210 lipase family protein, tetts-q237s3Tetrahymena thermophila SB210 lipase family protein, tetts-q237s4Tetrahymena thermophila SB210 lipase family protein, tetts-q240w1Tetrahymena thermophila SB210 lipase family protein, tetts-q241k3Tetrahymena thermophila SB210 lipase family protein, tetts-q242n3Tetrahymena thermophila SB210 lipase family protein.
LYsophospholipase_carboxylesterase : tetts-q22bw3Tetrahymena thermophila SB210 phospholipase/carboxylesterase family protein, tetts-q22ev8Tetrahymena thermophila SB210 phospholipase/carboxylesterase family protein, tetts-q23cn6Tetrahymena thermophila SB210 phospholipase/carboxylesterase family protein, tetts-q23sx6Tetrahymena thermophila SB210 phospholipase/carboxylesterase family protein, tetts-q24em5Tetrahymena thermophila SB210 hypothetical protein, tetts-q233x0Tetrahymena thermophila SB210 phospholipase/carboxylesterase family protein, tetts-q249e3Tetrahymena thermophila SB210 phospholipase/carboxylesterase family protein.
Monoglyceridelipase_lysophospholip : tetts-q22su1Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q23is4Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q23q75Tetrahymena thermophila SB210 hypothetical protein, tetts-q23vy9Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein, tetts-q24ew1Tetrahymena thermophila SB210 hypothetical protein, tetts-q24ew2Tetrahymena thermophila SB210 hypothetical protein, tetts-q24hy4Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q248y7Tetrahymena thermophila SB210 hypothetical protein.
PAF-Acetylhydrolase : tetts-q22mt6Tetrahymena thermophila SB210 isoform II family protein, tetts-q22nv7Tetrahymena thermophila SB210 platelet-activating factor acetylhydrolase, plasma/intracellular isoform II family protein, tetts-q230q3Tetrahymena thermophila SB210 platelet-activating factor acetylhydrolase, plasma/intracellular isoform II family protein, tetts-q240i0Tetrahymena thermophila SB210 isoform II family protein.
Palmitoyl-protein_thioesterase : tetts-q23sv8Tetrahymena thermophila SB210 palmitoyl protein thioesterase containing protein.
PC-sterol_acyltransferase : tetts-q22b72Tetrahymena thermophila SB210 lecithin:cholesterol acyltransferase family protein.
Pectinacetylesterase-Notum : tetts-q22n85Tetrahymena thermophila SB210 Pectinacetylesterase family protein, tetts-q23h69Tetrahymena thermophila SB210 Pectinacetylesterase family protein, tetts-q23h71Tetrahymena thermophila SB210 Putative uncharacterized protein, tetts-q23h73Tetrahymena thermophila SB210 Pectinacetylesterase family protein, tetts-q23pp9Tetrahymena thermophila SB210 Pectinacetylesterase family protein, tetts-q23pq0Tetrahymena thermophila SB210 Pectinacetylesterase family protein, tetts-q237q2Tetrahymena thermophila SB210 Pectinacetylesterase family protein.
PGAP1 : tetts-q22sa5Tetrahymena thermophila SB210 hypothetical protein.
PPase_methylesterase_euk : tetts-q244c7Tetrahymena thermophila SB210 hydrolase, alpha/beta fold family protein.
Proline_iminopeptidase : tetts-q22fd1Tetrahymena thermophila SB210 proline iminopeptidase family protein, tetts-q23d89Tetrahymena thermophila SB210 proline iminopeptidase family protein, tetts-q24a51Tetrahymena thermophila SB210 proline iminopeptidase family protein.
Prolylcarboxypeptidase : tetts-q22br8Tetrahymena thermophila SB210 serine carboxypeptidase s28 family protein, tetts-q22if7Tetrahymena thermophila SB210 serine carboxypeptidase s28 family protein, tetts-q22mf3Tetrahymena thermophila SB210 serine carboxypeptidase s28 family protein, tetts-q22n04Tetrahymena thermophila SB210 serine carboxypeptidase s28 family protein, tetts-q22n05Tetrahymena thermophila SB210 serine carboxypeptidase s28 family protein, tetts-q23ay4.2Tetrahymena thermophila SB210 serine carboxypeptidase s28 family protein.
S9N_PREPL_Peptidase_S9 : tetts-q246d1Tetrahymena thermophila SB210 prolyl oligopeptidase family protein

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		3 Genbank : CH445543, EAS03885, XP_001024130 1 UniProt : I7M3Q2 1 Interpro : I7M3Q2 1 Pfam : I7M3Q2 1 PIRSF : I7M3Q2 1 SUPERFAM : I7M3Q2

Sequence

Peptide

Graphical view for this peptide sequence: tetts-q247n8
Colored MSA for Duf_676 (raw)
IFKKTAFHLFVFVHGFQGNAFDMRLIKNHMMLLYPECLFLLSIQNEGRTE GNIEDMGKNLAKEIIDFVKKWCPGKQLGKISFVAHSLGGVIVRACLPLLK EDFQDKMFTFLSFGVPHLGYMHSKHSLINIGLWFLKTWRGSVCLNQLEMK DHKDLRQTYLYNLSKQEGLEWFRNVVFCSSTQDHYVPVESARVEKLQEQG GQSIQVYNEMVDNLLSNLKNDIQRLDINFEISENTEVNQSI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
IFKKTAFHLFVFVHGFQGNAFDMRLIKNHMMLLYPECLFLLSIQNEGRTE
GNIEDMGKNLAKEIIDFVKKWCPGKQLGKISFVAHSLGGVIVRACLPLLK
EDFQDKMFTFLSFGVPHLGYMHSKHSLINIGLWFLKTWRGSVCLNQLEMK
DHKDLRQTYLYNLSKQEGLEWFRNVVFCSSTQDHYVPVESARVEKLQEQG
GQSIQVYNEMVDNLLSNLKNDIQRLDINFEISENTEVNQSI

No Reference

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer