Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trimr-a0a0n5din9

Trichuris muris (Mouse whipworm) Uncharacterized protein

Comment
Mouse whipworm


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Trichuris muris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Enoplea: N E > Dorylaimia: N E > Trichinellida: N E > Trichuridae: N E > Trichuris: N E > Trichuris muris: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: trimr-a0a0n5din9
Colored MSA for Neuroligin (raw)
MSPTVAWLSLLLALLNVSSARGSFSSSSDTKIVQTSFGKLRGRVVHFRDL
GLPSVEQYLGVPYGTAPTGSKRFMMPQTASKWTNTVKDATELPPACVQLW
PRSVMHKSRSEALKVVNERIHGQVKRLVAMLRDQQEDCLYMNLFVPARRE
PEAELMPVVVIIHGDSYNWNSGSLYDGSILAAYGRLIVVTINYRLGVFGF
LSSGDPACKGNWALSDIVCALDVLRAMISDFGGDPSLVTLLGWDTGAALV
NLLMSSPISAPVDSRLFRRAILLGGSALSSWALANSPSEYFYQLADGLGC
QIYKQNHFGQQTLLAVQEVLECISTDSIENITRAATLLDLPTFLTNFGPV
IDGIVVNTDPSYNLENHGSLFQEIDLLVGATKHEAYDQLSTEHLQFGLDI
KNRDAIYRTFVRNRYSFHRTEIFNAIVNEYNDWYNPGQHPVTVRDSVLEA
IGDALYLAPLTKVVRLHARGKMPGGVHRTEDGAKRGKTFFYLFSHETSGN
PRYGLKGSVHAEDLPYILGYPLLNNHPPSIELNAFDFTFNKQERVISEVL
MRYVANFVKTGDPNEIQWDSALTDDVKFLERFRKLYWPEFYTTAKESCME
IREHPKVDSFYRAHEVAFWNNFLPSLESTGRTESNPEHHLLPQHFAKNSY
FGVVRPYDVGKMPFPPPPLPPTPIPKELTTILQNQQPAQAKLTPQKEASG
GAESSKEPTTNYSTILSVTIAVGCALLILNLLVFAGIYRQRERHRKGKRQ
ENSSGLLLQETSPYDMTGTYGGLIPSGSGQYSGSGSIMPAGGFGSGMTLP
SASPVASNVRDGEAYPYMQMQQRPSVANAYASGGSQQMIVPPEDDATFSV
TMHQQPQGMSPICPRHGKLTATSQAPKTQLEEIQV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPTVAWLSLLLALLNVSSARGSFSSSSDTKIVQTSFGKLRGRVVHFRDL
GLPSVEQYLGVPYGTAPTGSKRFMMPQTASKWTNTVKDATELPPACVQLW
PRSVMHKSRSEALKVVNERIHGQVKRLVAMLRDQQEDCLYMNLFVPARRE
PEAELMPVVVIIHGDSYNWNSGSLYDGSILAAYGRLIVVTINYRLGVFGF
LSSGDPACKGNWALSDIVCALDVLRAMISDFGGDPSLVTLLGWDTGAALV
NLLMSSPISAPVDSRLFRRAILLGGSALSSWALANSPSEYFYQLADGLGC
QIYKQNHFGQQTLLAVQEVLECISTDSIENITRAATLLDLPTFLTNFGPV
IDGIVVNTDPSYNLENHGSLFQEIDLLVGATKHEAYDQLSTEHLQFGLDI
KNRDAIYRTFVRNRYSFHRTEIFNAIVNEYNDWYNPGQHPVTVRDSVLEA
IGDALYLAPLTKVVRLHARGKMPGGVHRTEDGAKRGKTFFYLFSHETSGN
PRYGLKGSVHAEDLPYILGYPLLNNHPPSIELNAFDFTFNKQERVISEVL
MRYVANFVKTGDPNEIQWDSALTDDVKFLERFRKLYWPEFYTTAKESCME
IREHPKVDSFYRAHEVAFWNNFLPSLESTGRTESNPEHHLLPQHFAKNSY
FGVVRPYDVGKMPFPPPPLPPTPIPKELTTILQNQQPAQAKLTPQKEASG
GAESSKEPTTNYSTILSVTIAVGCALLILNLLVFAGIYRQRERHRKGKRQ
ENSSGLLLQETSPYDMTGTYGGLIPSGSGQYSGSGSIMPAGGFGSGMTLP
SASPVASNVRDGEAYPYMQMQQRPSVANAYASGGSQQMIVPPEDDATFSV
TMHQQPQGMSPICPRHGKLTATSQAPKTQLEEIQV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer