Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tsupd-d5us69

Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / JCM 10117 / NBRC 16120 / NCTC 13040) (Corynebacterium paurometabolum) Tpau_0495 Alpha/beta hydrolase fold protein

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Tsukamurella paurometabola DSM 20162
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Tsukamurellaceae: N E > Tsukamurella: N E > Tsukamurella paurometabola: N E > Tsukamurella paurometabola DSM 20162: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_013125178
1 UniProt : D5US69
1 UniProt : D5US69
1 Interpro : D5US69
1 Pfam : D5US69
1 PIRSF : D5US69
1 SUPERFAM : D5US69
Sequence
Graphical view for this peptide sequence: tsupd-d5us69
Colored MSA for Epoxide_hydrolase (raw)
MTITPHTVRTERHTTGYLASGPEDGPLLVFCHGWPELSYSWRHQLTALGG
LGFRCIAPDMRGYGASSVPAAKDAYRREEIVADMLELLAGVGREAAIWIG
HDWGAPVVWNIATHHPGVVDAVASLNVPHFPSGGPGPVDLIDREKYPADE
YPYGQWDYQVHYLKHFDEVTAQFESDIPHFIAALFRVGEPSHLDRPAPTA
VVSRNGGWFGGGAVPRVPIDPAVLTTEDHAVYTAAFERNGMAGPNSWYVN
GAADAEYAARELNHGRIDVPVLFLHGRYDATLETVRSSLADPMRAACANL
TEVILDCGHWTAEEKPAEVSASLARWIATRVPGRWPAPAENHPAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTITPHTVRTERHTTGYLASGPEDGPLLVFCHGWPELSYSWRHQLTALGG
LGFRCIAPDMRGYGASSVPAAKDAYRREEIVADMLELLAGVGREAAIWIG
HDWGAPVVWNIATHHPGVVDAVASLNVPHFPSGGPGPVDLIDREKYPADE
YPYGQWDYQVHYLKHFDEVTAQFESDIPHFIAALFRVGEPSHLDRPAPTA
VVSRNGGWFGGGAVPRVPIDPAVLTTEDHAVYTAAFERNGMAGPNSWYVN
GAADAEYAARELNHGRIDVPVLFLHGRYDATLETVRSSLADPMRAACANL
TEVILDCGHWTAEEKPAEVSASLARWIATRVPGRWPAPAENHPAG


References
    Title: Efficient kinetic resolution of phenyl glycidyl ether by a novel epoxide hydrolase from Tsukamurella paurometabola
    Wu K, Wang H, Sun H, Wei D
    Ref: Applied Microbiology & Biotechnology, 99:9511, 2015 : PubMed

            

    Title: A novel enantioselective epoxide hydrolase for (R)-phenyl glycidyl ether to generate (R)-3-phenoxy-1,2-propanediol
    Wu S, Shen J, Zhou X, Chen J
    Ref: Applied Microbiology & Biotechnology, 76:1281, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer