Gene_locus Report for: ustma-q4p8v8Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Ustilaginomycotina: N E > Ustilaginomycetes: N E > Ustilaginales: N E > Ustilaginaceae: N E > Ustilago: N E > Ustilago maydis: N E > Ustilago maydis 521: N E
6_AlphaBeta_hydrolase : ustma-q4p1m4Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p2u2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p544Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pbl1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4phd7Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pi12Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. A85-EsteraseD-FGH : ustma-q4p633Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. ABHD11-Acetyl_transferase : ustma-q4pdj1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. ABHD13-BEM46 : ustma-q4p5b4Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Acidic_Lipase : ustma-q4p139Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. AlphaBeta_hydrolase : ustma-q4pd13Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pd19Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Canar_LipB : ustma-q4pep1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) Ustilago maydis lipase 2 (Uml2). Carboxypeptidase_S10 : ustma-q4p5h2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p7d8Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p7g6Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p8u8Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pdc5Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pdc7Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. CFTR-inhibitory-factor_Cif : ustma-q4p052Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. CGI-58_ABHD5_ABHD4 : ustma-q4p0v2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Cocaine_esterase : ustma-q4p906Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Cutinase : ustma-q4p8k0Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p198Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pbk7Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4phg8Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Dienelactone_hydrolase : ustma-q4pbi1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pdv1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. DPP4N_Peptidase_S9 : ustma-q4p3p0Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Duf_1100-S : ustma-q4pcx8Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Epoxide_hydrolase : ustma-q4p6v2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p750Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pd75Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pdg1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. FSH1 : ustma-q4p0t2Ustilago maydis (Corn smut fungus); Sporisorium reilianum (Maize head smut fungus)); Ustilago hordei; Moesziomyces Pseudozyma antarctica; Pseudozyma hubeiensis; Kalmanozyma brasiliensis; Moesziomyces Pseudozyma antarctica; Sporisorium scitamineum; Sporisorium reilianum; Sporisorium graminicola, hypothetical protein. Fungal-Bact_LIP : ustma-q4p903 Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) lipase UM03410, ustma-q4pe08Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Fungal_carboxylesterase_lipase : ustma-A0A0D1BV83Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-A0A0D1BW24Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-A0A0D1DYF7Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-A0A0D1DTW1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-A0A0D1C5D2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-A0A0D1E8B5Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Homoserine_transacetylase : ustma-q4p1g6Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p8y8Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Hormone-sensitive_lipase_like : ustma-q4p6b4Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p9t5Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p075Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p081Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p414Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p742Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pbj2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pg61Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pgx6Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Lipase_3 : ustma-q4pbm4Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pcp7Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pcq2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pdu2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein (c-term 550->), ustma-q4phr5Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4phz2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. LYsophospholipase_carboxylesterase : ustma-apth1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4p3f4Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Monoglyceridelipase_lysophospholip : ustma-q4pih8Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) Sporisorium reilianum (strain SRZ2) (Maize head smut fungus) hypothetical protein. PAF-Acetylhydrolase : ustma-q4pd86Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein, ustma-q4pid0Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Palmitoyl-protein_thioesterase : ustma-q4p2m2Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. PC-sterol_acyltransferase : ustma-q4phu1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. PGAP1 : ustma-q4p782Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. Proline_iminopeptidase : ustma-q4phi1Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein. S9N_PPCE_Peptidase_S9 : ustma-q4p3m5Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) Prolyl endopeptidase. Thioesterase : ustma-q4p0e9Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) hypothetical protein
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: ustma-q4p8v8
Colored MSA for Duf_676 (raw)
MLGRFKETVAEARAHVTACARTDGTSTQALGTSMLAGSVHLVVIHHGLWG
SPANTEYLATTLAKYHGGLISPHCTLTPPECASTISALASTHPNSTNHIR
MVVLNSEVNSGDHTYDGIDWCAERLIKDVYREVERIEQDENAKVAKLSLI
GYSLGGLVIRYAAGVMYSDGLFAESKCNTGKKLMFTSRPVAASMSTIATP
HLGVTLTGSMFSKVAAAVGRSNLGRTGKQLYLADRGWKADSHLSTQETPK
HAHAQSDEDEGLCLIEALSDPRFNFITAMRLFSRIDVYANAVADLTVSYR
TAAFEAHDPFVLADQIHLVRDPDHPPLVVSFSITKPCNKTTPFWSTLAAK
LSPNNLPWMLNPQRFPIRFPLNYVALLCLPVVLPVMVGLVLHKLRSDSRV
SNRRVEEFERLWAVENAGLSGKDPVIQDDSLNRKNGKKEKSVSTLVKLDA
ATRGELERKRVANLLATVEAEVEETFREVGEDYVRTSAPMASPAPSDSRY
ITKTNDATTFAPRSSYASLPEQQPLLPTQHRILSNLNNASLLPQVKKHLA
HFPDVLNSHAVIIVRTPTMDAHKKGMQLIKAFVQRFEL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLGRFKETVAEARAHVTACARTDGTSTQALGTSMLAGSVHLVVIHHGLWG
SPANTEYLATTLAKYHGGLISPHCTLTPPECASTISALASTHPNSTNHIR
MVVLNSEVNSGDHTYDGIDWCAERLIKDVYREVERIEQDENAKVAKLSLI
GYSLGGLVIRYAAGVMYSDGLFAESKCNTGKKLMFTSRPVAASMSTIATP
HLGVTLTGSMFSKVAAAVGRSNLGRTGKQLYLADRGWKADSHLSTQETPK
HAHAQSDEDEGLCLIEALSDPRFNFITAMRLFSRIDVYANAVADLTVSYR
TAAFEAHDPFVLADQIHLVRDPDHPPLVVSFSITKPCNKTTPFWSTLAAK
LSPNNLPWMLNPQRFPIRFPLNYVALLCLPVVLPVMVGLVLHKLRSDSRV
SNRRVEEFERLWAVENAGLSGKDPVIQDDSLNRKNGKKEKSVSTLVKLDA
ATRGELERKRVANLLATVEAEVEETFREVGEDYVRTSAPMASPAPSDSRY
ITKTNDATTFAPRSSYASLPEQQPLLPTQHRILSNLNNASLLPQVKKHLA
HFPDVLNSHAVIIVRTPTMDAHKKGMQLIKAFVQRFEL
|
|
|
|
