Fasciculin1

Peptide of 61 residues isolated from Dendroaspis angusticeps (green mamba) venom. Potent inhibitor of some vertebrates AChE. More info mamba-fasc1

General

Type : Natural, Peptide

Chemical_Nomenclature : TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY

Canonical SMILES :

InChI :

InChIKey :

Other name(s) :


MW : 7 kD

Formula :

CAS_number :

PubChem :

UniChem :

Target

Families : Fasciculin1 ligand of proteins in family
ACHE

Structure :
1FAS

References (24)

Title : Therapeutic Promise and Biotechnological Prospects of Dendroaspis polylepis Venom Proteins: Mambalgins, Fasciculins, and Dendrotoxins - Kowalczyk_2025_Int.J.Mol.Sci_26_
Author(s) : Kowalczyk T , Muskala M , Piekarski J , Kowalski M , Staszewski M , Konuklugil B , Rijo P , Sitarek P
Ref : Int J Mol Sci , 26 : , 2025
Abstract :
PubMedSearch : Kowalczyk_2025_Int.J.Mol.Sci_26_
PubMedID: 41155192

Title : Therapeutic Promise and Biotechnological Prospects of Dendroaspis polylepis Venom Proteins: Mambalgins, Fasciculins, and Dendrotoxins - Kowalczyk_2025_Int.J.Mol.Sci_26_
Author(s) : Kowalczyk T , Muskala M , Piekarski J , Kowalski M , Staszewski M , Konuklugil B , Rijo P , Sitarek P
Ref : Int J Mol Sci , 26 : , 2025
Abstract :
PubMedSearch : Kowalczyk_2025_Int.J.Mol.Sci_26_
PubMedID: 41155192

Title : Therapeutic Promise and Biotechnological Prospects of Dendroaspis polylepis Venom Proteins: Mambalgins, Fasciculins, and Dendrotoxins - Kowalczyk_2025_Int.J.Mol.Sci_26_
Author(s) : Kowalczyk T , Muskala M , Piekarski J , Kowalski M , Staszewski M , Konuklugil B , Rijo P , Sitarek P
Ref : Int J Mol Sci , 26 : , 2025
Abstract :
PubMedSearch : Kowalczyk_2025_Int.J.Mol.Sci_26_
PubMedID: 41155192

Title : Conformational comparison in the snake toxin family - Falkenstein_1996_Int.J.Pept.Protein.Res_47_167
Author(s) : Falkenstein RJ , Pena C , Biscoglio MJ , Bonino DJ
Ref : Int J Pept Protein Res , 47 :167 , 1996
Abstract :
PubMedSearch : Falkenstein_1996_Int.J.Pept.Protein.Res_47_167
PubMedID: 8740966

Title : Conformational comparison in the snake toxin family - Falkenstein_1996_Int.J.Pept.Protein.Res_47_167
Author(s) : Falkenstein RJ , Pena C , Biscoglio MJ , Bonino DJ
Ref : Int J Pept Protein Res , 47 :167 , 1996
Abstract :
PubMedSearch : Falkenstein_1996_Int.J.Pept.Protein.Res_47_167
PubMedID: 8740966

Title : Conformational comparison in the snake toxin family - Falkenstein_1996_Int.J.Pept.Protein.Res_47_167
Author(s) : Falkenstein RJ , Pena C , Biscoglio MJ , Bonino DJ
Ref : Int J Pept Protein Res , 47 :167 , 1996
Abstract :
PubMedSearch : Falkenstein_1996_Int.J.Pept.Protein.Res_47_167
PubMedID: 8740966

Title : Muscarinic toxins from the venom of Dendroaspis snakes with agonist-like actions - Jerusalinsky_1995_Toxicon_33_389
Author(s) : Jerusalinsky D , Kornisiuk E , Bernabeu R , Izquierdo I , Cervenansky C
Ref : Toxicon , 33 :389 , 1995
Abstract :
PubMedSearch : Jerusalinsky_1995_Toxicon_33_389
PubMedID: 7570625

Title : Muscarinic toxins from the venom of Dendroaspis snakes with agonist-like actions - Jerusalinsky_1995_Toxicon_33_389
Author(s) : Jerusalinsky D , Kornisiuk E , Bernabeu R , Izquierdo I , Cervenansky C
Ref : Toxicon , 33 :389 , 1995
Abstract :
PubMedSearch : Jerusalinsky_1995_Toxicon_33_389
PubMedID: 7570625

Title : Muscarinic toxins from the venom of Dendroaspis snakes with agonist-like actions - Jerusalinsky_1995_Toxicon_33_389
Author(s) : Jerusalinsky D , Kornisiuk E , Bernabeu R , Izquierdo I , Cervenansky C
Ref : Toxicon , 33 :389 , 1995
Abstract :
PubMedSearch : Jerusalinsky_1995_Toxicon_33_389
PubMedID: 7570625

Title : 1.9-A resolution structure of fasciculin 1, an anti- acetylcholinesterase toxin from green mamba snake venom - le Du_1992_J.Biol.Chem_267_22122
Author(s) : le Du MH , Marchot P , Bougis PE , Fontecilla-Camps JC
Ref : Journal of Biological Chemistry , 267 :22122 , 1992
Abstract :
PubMedSearch : le Du_1992_J.Biol.Chem_267_22122
PubMedID: 1429564

Title : 1.9-A resolution structure of fasciculin 1, an anti- acetylcholinesterase toxin from green mamba snake venom - le Du_1992_J.Biol.Chem_267_22122
Author(s) : le Du MH , Marchot P , Bougis PE , Fontecilla-Camps JC
Ref : Journal of Biological Chemistry , 267 :22122 , 1992
Abstract :
PubMedSearch : le Du_1992_J.Biol.Chem_267_22122
PubMedID: 1429564

Title : 1.9-A resolution structure of fasciculin 1, an anti- acetylcholinesterase toxin from green mamba snake venom - le Du_1992_J.Biol.Chem_267_22122
Author(s) : le Du MH , Marchot P , Bougis PE , Fontecilla-Camps JC
Ref : Journal of Biological Chemistry , 267 :22122 , 1992
Abstract :
PubMedSearch : le Du_1992_J.Biol.Chem_267_22122
PubMedID: 1429564

Title : Preliminary X-ray analysis of crystals of fasciculin 1, a potent acetylcholinesterase inhibitor from green mamba venom - Menez_1990_J.Mol.Biol_216_233
Author(s) : Menez R , Ducruix A
Ref : Journal of Molecular Biology , 216 :233 , 1990
Abstract :
PubMedSearch : Menez_1990_J.Mol.Biol_216_233
PubMedID: 2254925

Title : Preliminary X-ray analysis of crystals of fasciculin 1, a potent acetylcholinesterase inhibitor from green mamba venom - Menez_1990_J.Mol.Biol_216_233
Author(s) : Menez R , Ducruix A
Ref : Journal of Molecular Biology , 216 :233 , 1990
Abstract :
PubMedSearch : Menez_1990_J.Mol.Biol_216_233
PubMedID: 2254925

Title : Preliminary X-ray analysis of crystals of fasciculin 1, a potent acetylcholinesterase inhibitor from green mamba venom - Menez_1990_J.Mol.Biol_216_233
Author(s) : Menez R , Ducruix A
Ref : Journal of Molecular Biology , 216 :233 , 1990
Abstract :
PubMedSearch : Menez_1990_J.Mol.Biol_216_233
PubMedID: 2254925

Title : Rat striatal acetylcholinesterase inhibition by fasciculin (a polypeptide from green mamba snake venom) - Dajas_1987_Neurosci.Lett_77_87
Author(s) : Dajas F , Bolioli B , Castello ME , Silveira R
Ref : Neuroscience Letters , 77 :87 , 1987
Abstract :
PubMedSearch : Dajas_1987_Neurosci.Lett_77_87
PubMedID: 3601220

Title : Rat striatal acetylcholinesterase inhibition by fasciculin (a polypeptide from green mamba snake venom) - Dajas_1987_Neurosci.Lett_77_87
Author(s) : Dajas F , Bolioli B , Castello ME , Silveira R
Ref : Neuroscience Letters , 77 :87 , 1987
Abstract :
PubMedSearch : Dajas_1987_Neurosci.Lett_77_87
PubMedID: 3601220

Title : Rat striatal acetylcholinesterase inhibition by fasciculin (a polypeptide from green mamba snake venom) - Dajas_1987_Neurosci.Lett_77_87
Author(s) : Dajas F , Bolioli B , Castello ME , Silveira R
Ref : Neuroscience Letters , 77 :87 , 1987
Abstract :
PubMedSearch : Dajas_1987_Neurosci.Lett_77_87
PubMedID: 3601220

Title : Anticholinesterase toxins -
Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D
Ref : Pharmacol Ther , 30 :259 , 1985
PubMedID: 3842891

Title : Anticholinesterase toxins -
Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D
Ref : Pharmacol Ther , 30 :259 , 1985
PubMedID: 3842891

Title : Anticholinesterase toxins -
Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D
Ref : Pharmacol Ther , 30 :259 , 1985
PubMedID: 3842891

Title : Fasciculins, anticholinesterase toxins from the venom of the green mamba Dendroaspis angusticeps - Karlsson_1984_J.Physiol.(Paris)_79_232
Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D
Ref : Journal de Physiologie (Paris) , 79 :232 , 1984
Abstract :
PubMedSearch : Karlsson_1984_J.Physiol.(Paris)_79_232
PubMedID: 6530667

Title : Fasciculins, anticholinesterase toxins from the venom of the green mamba Dendroaspis angusticeps - Karlsson_1984_J.Physiol.(Paris)_79_232
Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D
Ref : Journal de Physiologie (Paris) , 79 :232 , 1984
Abstract :
PubMedSearch : Karlsson_1984_J.Physiol.(Paris)_79_232
PubMedID: 6530667

Title : Fasciculins, anticholinesterase toxins from the venom of the green mamba Dendroaspis angusticeps - Karlsson_1984_J.Physiol.(Paris)_79_232
Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D
Ref : Journal de Physiologie (Paris) , 79 :232 , 1984
Abstract :
PubMedSearch : Karlsson_1984_J.Physiol.(Paris)_79_232
PubMedID: 6530667