Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Fungal-D14-Strigolactone-R

Fungal-D14-Strigolactone-R


Genes:Proteins in Fungal-D14-Strigolactone-R (28)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9euro-a0a0n1hc14: Phialophora attinorum. AB hydrolase-1 domain-containing proteinPhialophora attinorum Show
MPHLTLPDGRTLDYAIDGAQTGFPFVFIHGTPGSVNSTLPSLKSLCKQKG
LKIISMSRAGYGDSSRHAGRAVIDNVADVKALLEHLGVATCVAGGWSGGG
PHVLALAAKLPGVKAALCVAGVAPADAPDLDFLAGQGQDNVDEFTAASAG
EVELRKFLDPQREALLQADAAGVTKEMSSILPEVDKQAMLKNAELGQSIV
DGFQEALKHGVDGWCDDDLEFTKHGALTWPRSSHGQWLAKHLPQEKLRKH
LVQGEGHISIFLEYVNTMIDELLEVVRAY
9euro-a0a2h3iyg9: Penicillium sp. 'occitanis'. AB hydrolase-1 domain-containing protein, 1 reference(s)Penicillium sp. 'occitanis' Show
MPQQFQQLQLPDGRNLDYCVNGPQDGFPLVFIHGTPGSGIPVPNLVTACA
KKGIKVITFSRAGYGGSTRNKGRQVVDNVADIKSLLDHLGVKKCLVAGWS
GGGPSTLACAARLSECLAAVSFAGVGPYGVEGLDFLAGQGEDNIEEYNKA
LEGEPQLREFCEGHRKEYLVSELDGVMEAMSTLLPPPDNATLLQNRDTIG
QNIVDTFREGLRLSPDGWIDDDFGFLKPWGFELSEVRVPVLLLQGTEDKM
VPFAHGKWLAEHLPQDKVKAHLLEGHGHISLFDGIDGIIDELVAAANL
9euro-a0a225ac49: Talaromyces atroroseus. AB hydrolase-1 domain-containing proteinTalaromyces atroroseus Show
MAYQLQNLQLPDGRNLDYSVAGPEDAKISLIWIHGTPGAAIPVPTVVTAC
AKKGIKVIAFSRPGYGGSTRRKGRRVIDAVDDIQYLKEHLGVKQCLVGGW
SGGGPHTLACAARLPGCLAAVTFAGGAPYHAEGLDYLAGQGEDNVQEFSA
AIQGEAQLRAFCEPQREALIQSDLEAVMAALDSLLPPVDNECMKQNRDTI
GQNMVDVMCEAFRLGCDGWIDDDLENIGADSWGFELSEVKVPVLILQGDL
DKMVPYAHGKWLADHLPQDKVRRHLMQGHGHISILANVDDIIDELLTEAK
L
9euro-a0a364kue4: Talaromyces amestolkiae. AB hydrolase-1 domain-containing protein, 1 reference(s)Talaromyces amestolkiae Show
MPQQFQQHQLPDGRNLDYCVSGPEDGFPLVFIHGTPGAGIPIPNLVDACA
RKGIKVITFSRAGYGGSTRKKGRQVVDSVADIKSLIDHLGVKKCLVGGWS
GGGPSTLACAARLHECLAAVSFAGVAPYNVEGLDWLAGQGEDNIDEFNKA
LEGETQLREFCDGHRKEYLASELDGVMEVMSTLLPPCDNATLLQNKDTIG
QQMVDSFHEGLRISSDGWIDDDLEFFQPWGFELSEVRVPLLLLQGTEDKM
VPFAHGKWLAEHLPQDKVKVHLLEGHGHISLFDGIDGIIDELVAAANL
9euro-w9wli6: Cladophialophora psammophila CBS 110553. AB hydrolase-1 domain-containing proteinCladophialophora psammophila CBS 110553 Show
MAKQLTLPDGRNLDYSITGAREGFPLIWCHGTPSGYIPIPALARSCEKKG
LKLVTFSRSGYGGSSRRKGRNIVDDVDDVRALSKHLGHDKFVVGGWSGGG
PHSLACAAKLEGCVASIVIAGVAPYNVEGLDWLAGQGQDNIDEYAASMKG
EYALREYCDAQRPGLISSTAAGIIEQLSAILPEVDKRALRESAELGSYME
QTMREGLKSSCDGWIDDDFAFLAPWGFDVADIKVPVFLYQGSEDLMVPFA
HGQWLGSHINQKYLTNHLEQGEGHISIFLGRVDTMLDEIKAVIDDKAQ
9helo-a0a1l7wva3: Phialocephala subalpina. AB hydrolase-1 domain-containing proteinPhialocephala subalpina Show
MAQQLHLPDGRIIEYLVSGDQDGFPLVWIHGTPGAYLPVPSLVTACKKKG
IKIISLSRDGYGGSSRNKGRRVVDAVVGIQAVNEHLGIERCLVGGWSGGG
PHALACAARLTGCIATLCVAGPAPYEAEGLDFLAGQSEDNIQEFHATLKG
EEELQKFCGAQRSEILQSDVAGLIAELDSLFPEVDKQAMATSPEMGQYTV
DMFREALRISCDGWVDDDLAMINPWGFEFNEIKVPVLLYQGSEDKMVPYA
HGEWLAKHLPQDKLRKHLIPGEGHMSIFIGHKDQMVDELLEMTKS
9helo-a0a2j6rs12: Hyaloscypha variabilis F. Putative valacyclovir hydrolaseHyaloscypha variabilis F Show
MMAQQFTHPDGRNIDYQVYGAKDGFPLVWIHGTPGAYIPYQGLVTLCEKK
GIKLISLSRAGYGGSTRHKGRRVVDVVADIEALNKHLGIEKCLVGGRSGG
GPHALACAARLPTCIAALCLSGVAPWNSEGLDFLAGQGQSNIDEINAALR
GEDELEKFCKAMRLEILKADVSSIMAGMTSLLTEVDKKALTKNTEMGQFV
VDTVNESLKIGCDGWVDDDLAFINPWGFELNEIKVPVILYHGDEDKLAPF
AHGEWLAKNLPQEFLRKHLVQGEGHLSLFLERTDDMIDELLEIAKL
9helo-a0a3d8qpi0: Coleophoma cylindrospora. Uncharacterized protein, 1 reference(s)Coleophoma cylindrospora Show
MAQQLNLPDGRNLDYLVSGAKDGFPLVWIHGTPGAYMPPPSLVTACEKKG
IMVISFSRAGYGGSTRKQGRQIVDYVADTQALIDHLGVERCLVGGWSGGG
MFPCPHALVSAARLRGCVAALCVAGVALYDAEGLDFLAGQGEDNIVEFNA
ALRGIDELQKFCAISRTEMLKGDVAGMVEAMSSLLPDVDKDALMNGNGMG
EYLHGTINEGLKISANGWVDDTMSSLKPWGFELSEIKVPVIVYQGSEDKM
VPYAHGEWLVNHLPQEKLSKHLMQGQGHVSIFIGQEDTMLDELLDVAKL
9pezi-a0a0c3dbl8: Oidiodendron maius Zn. AB hydrolase-1 domain-containing proteinOidiodendron maius Zn Show
MAHQFQLPDGRNLDYVVHGPKDGFPVVWIHGTPGAYIPTPELTNICEKKN
FKLISASRAGYGGSTRNKGRRIVDVVADLHALNQHLGVEQCIVAGWSGGG
PHALACAARLPGALAALCVAGMAPYDARGLDWMAGQGQDNINETEASLQG
EEVLRKYCESQRGGLLKADVAGIVEGLSSILPPVDSEVILKNASMGQNMV
ETIHVALKNSVDGWIDDDLSFITSWGFELDEIKIPVLLYQGGEDKMVPYG
HGQWLAENLPQDKLRKHLEPRDGHISIFIGRGEKIIDELLEAAKVTSVD
9pezi-a0a0c3hhg0: Oidiodendron maius Zn. AB hydrolase-1 domain-containing proteinOidiodendron maius Zn Show
MAQQFQLPDGRYVDYAVNGPENGYPLVWIHGTPGSYIPVPNILAACEKKG
VKVITLSRAGYGGSSRNKGRKIVDAVADIHALNEHLDVKQCIVGGWSGGG
PHALACAARLPGCVAAVCVAGIAPYDAEGLDWTAGQGQDNIDETNATLQG
EEALQEYCAAQRAEILNADVAGIIEAMSSLLPTVDKEALVQSSEMGQHMV
ELMNEGLRVGSDGWVDDDLTFVKPWGFDLSEIKVPLLLYQGSEDKMVPFS
HGEWLAEHLPQEKLKKHLIQGQGHISIFVGQCDGIIDDLLEIAKTA
9pezi-a0a0g2g006: Diaporthe ampelina. Putative alpha beta hydrolaseDiaporthe ampelina Show
MAAQSLTHPDGRKTEYLISGAQDGFPLVFIHGTPGSYTVGPKMRAACEGK
GIKLITLSRAGYGGSTRNKGRRVVDAVADIQALLEHLGVKKCVVGGRSGG
GPHSLACAARLPGCVASLVVAGVGPFNADGLDFLAGQGQGNVDEWAAALK
GEEELQRFCQAERPGMLAADAKGLTEALTTLLPEVDKRAMLEDENTGDDI
VRTMQEALRVSCDGWVDDDLAFTRPWGFDLGEVKVPVFLYQGSEDKMVPL
AHGQWLAGHLPRGNVKARLLQGEGHISIFSGYVDEMLDNLLAVARE
9pezi-a0a1v8sez1: Rachicladosporium antarcticum. AB hydrolase-1 domain-containing proteinRachicladosporium antarcticum Show
MSQQFKLHDGRVIDFHIDGDTNGYPFIWLHGTPGSRLAVPPSLDELCKIK
GLKIIALSRPGYGDSSRHEGRVVVDTVADVTALNEHLGIKDCVVGGWSGG
GPHVLACAARLKGVKAALCVAGCAPYGKDDLDFLAGQGQDNIDEFNAALE
GKTALRKLLDSQRPGLLAADAAGLVQEMASILPEVDKKALLSNATLGQGV
VEGIHEGLKHSTDGWFDDDMELMNPWGFEVEEVKVPTAVWQGSEDQMVPF
AHGEWIVKHLPDEWCKAHLLQGEGHISVFIEHVGTMVEELLEGVKR
9pezi-a0a1v8smv5: Rachicladosporium antarcticum. AB hydrolase-1 domain-containing proteinRachicladosporium antarcticum Show
MSQQFKLHDGRVIDFHIAGDTNGYPLIWLHGTPGSRLAVPPSLDELCNTK
GLKVIAISRPGYGDSSRHEGRVVVDTVADVTALNEHLGIKDCVVAGWSGG
GPHVLACAARLKGVKAALCVAGCAPYGKDDLDFLAGQGQDNIDEFNATLA
GAPALRKLLDSQRPGLLAADAAGLVQEMATILPEVDKKALLSNAALGQGV
VEGIHEGLKHNTDGWFDDDMELMKPWGFEVEEVKVPTAVWQGSEDQMVPF
AHGEWIVKHLPDQWCKAHLLQGEGHISVFMEHVGTMIQELLDELKN
9pezi-a0a2p5i9r2: Diaporthe helianthi. Alpha/beta hydrolase fold proteinDiaporthe helianthi Show
MTAQVLSHADGRKTDFLISGAKDGFPLVFIHGTPGSYTVGSNLSSTCERK
GIKLITLSRAGYGGSSRKLGRRVVDAVADIHELLEHLGVKKCIVGGKSGG
GPHSLACAARLPGCVAALVVAGVGPYNVDGLDFLAGQGQGNIDEWAAALK
GEEEIQKFCQAERPGLLAADAEGLTKALLSTLLPEVDKKAMLEDENTGND
VVTSMHEALRVSCDGWVDDDLAFIQPWGFDFDEINVPVFLYQGSEDKMVP
LEHGKWQADHLPKDKVKARLVDGEGHISIMAGYLEEMLDNLLAVARVHER
9pezi-a0a2t2zy46: Coniella lustricola. Putative valacyclovir hydrolase, 1 reference(s)Coniella lustricola Show
MTHQTLTLPDGRTLEYVVSGANDKHANDDFALLYFHGTVGSSLPYVQTSD
ACRQAGIKLITPSRPGYGGSTRHKGRRVVDVVADMEALLAELKVRSCVAV
GHSGGGPHAMACAAKLQACVAAVVIAGAVPVDAEGLDYAAGQGETNVEEW
LAMQQGEPAVRAYCTQEATSMLAADARTLTDALASLLPAIDKDALRANNC
SMGQHLVDQIQDGLRDGQIDGWVDDDLELMQEWGFDLTTEVKVPTHVYQG
SEDRMVPLAHGEWLAGHLPAGLVNKRVVHGQGHISILGLAMDEVLALAGA
LKRSEEGLV
9pezi-a0a2t3akb4: Coniella lustricola. Putative valacyclovir hydrolase, 1 reference(s)Coniella lustricola Show
MDSHVVALPDGRKLDYALAGAEKGIPLVFLHGTPGSYIANADFKAACARK
GIKLITFSRPGYGNSSRQRGRKVVDVVADIVALLEHLGLKETLVAGYSGG
GPHALACAARLPGCLAVLSIASPAPFGVEGLDWWEGLGKDNITEFAFALQ
GEAPLAKFLAAERPGMLSATPTQLVENMSSLLPETDSKVLLNNPSVGEEW
VTTLAQALQHDVDGWLDDDLAFVDGDQSWGFALDEIKAPVLLWQGYEDKM
VPLGQGKWLAANLPADKVEAHLLEGYGHVSIFYQNLDVMLDGLLVAAGQ
9pezi-a0a6h0xw94: Peltaster fructicola. AB hydrolase-1 domain-containing proteinPeltaster fructicola Show
MARQFTLSDGRKLDYRVAGKPDATPLLWFHGTPGASLPPPGIEAACEKYG
LSIISFSRPGYGSSTRQKGRLVADTVVDAAELMKHLGHTRFYTGGWSGGG
PYALTTAIKLPGCLAALVIAGVAPYDGEGLDYLAGQGQDNIDETNAALTG
EEALQAFTKPRRVEMLQASVEELVEGLSSVLPEVDQRALLDGGDLGSYTV
ATFAEALTGSSDGWVDDDLAFTLPWGVNVKDIRVPVFLHHGSLDAAVPFA
HGEWIAAHIPKEYLTKHFEQGEGHVSIYVGRVDGMISELVASTS
9pezi-a0a150vii2: Acidomyces richmondensis BFW. AB hydrolase-1 domain-containing protein, 1 reference(s)Acidomyces richmondensis BFW Show
MAKHFKLKDGRSLQYDVSGAKNGFPLVWIHGTPGAYTALPSLSAACEKKG
LQLVGFSRAGYGDSSRCHGRSIIDIIPDIESLLHHLGHEKCYVGGWSGGG
PHALACAARLKGCVASLVIASVAPYDAEGLDFMAGQGQDNIEETEASLKG
EEVLREYLEAQRKDLMQADVTGLTEMLASILPEIDKKALLENDEMGSYTV
DSFKTGLKHNCDGWIDDDLSFIKPWGFDVSEVSCPVFLYHGSVDMMCPYS
HGQWIASHLPQHSTKHLIDGQGHISIFFAHMDEMMDELLSVSK
9pezi-a0a507ana3: Phialemoniopsis curvata. AB hydrolase-1 domain-containing proteinPhialemoniopsis curvata Show
MSEQVLSINGRTLAYRIFGDPDGSLPLIWFHGTPAGCTPPPSLVAAAKTS
GVRIIAPERPGYGDSARRPGRKIIDMVGDVEALKTHLGVDKCLIAGWSGG
GPHALACGARLPGVLAVLTIAGVGPADAKDLDFLAGQGEDNVVEFHAAMK
GEDALREFCTAQRKDIVSGSVARAVAALSSILSGVDLEASKGDLGVYLVE
LLREGLRNGIEGWVDDDLEFVLPWGFELSEIKVPVLLYQGSDDKMVPYAH
GKWLADHLPKEHLRAHLIEGEGHVSLVAKGEALLSELIEAAKAASG
baupa-m2luc8: Baudoinia panamericana (strain UAMH 10762) (Angels' share fungus) (Baudoinia compniacensis (strain UAMH 10762)). AB hydrolase-1 domain-containing protein, 1 reference(s)Baudoinia panamericana Show
MASQLKLPDGRILDYYVAAQATDSYKPPVIWVHGTPGAYPVFPDILSACE
RKGLGLVTFSRSGYGGSSRRKGRRIVDEVDDVQSLMEHLGHQMALVCGWS
GGGPVTLACAARLQGCVAALVIASVGPYGVDGLDFLAGMGQDNIDEFNAT
TKGEEALKEFCTREREGMLQVDGAGLTEFLSSILPPVDKRAMLEHDTLGN
YTADAIKEGLKHGCDGWMDDDLSSVQPWGFDFGEIHCPISLYHGSEDKMV
PYSHGKWLAEHIPKQHLTAHLVEGEGHLSIVLGRLDDMLDELLGAASLK
cordf-a0a168fit9: Akanthomyces lecanii RCEF 1005. AB hydrolase-1 domain-containing protein, 1 reference(s)Akanthomyces lecanii RCEF 1005 Show
MDQVFRLTDGRQLSYSVSAATDGIPLIFLHGTPGNKAVLPAFEAKCKSRG
VKLITTDRAGYGGSTRQKGRRVADVVDDIKQLTQHLSISKCLVAGWSGGG
PHALACAARLPGCLAALLVASVGPSDADDLDFLSGQGEGNLQEFHAALQG
EAKLREFCEAERPDMMGDAQSIMTAMASNLPEVDKAAILRDPDFGNYLSQ
SFREGLQVNCDGWIDDDLAFLQPWGFDVGENKTHVLLYQGRDDKMVPFAH
GEWIAQHLPAGTAQVRLLEGQGHISIFLDHVDEMIDGLLKHC
crypa-CpD14: Cryphonectria parasitica (Chestnut blight fungus) (Endothia parasitica) EP155 M406DRAFT_70182 CpD14 Strigolactone hydrolase receptor from fungi, 1 reference(s)Cryphonectria parasitica EP155 Show
MATSNTTNPQVLSLPDGRNLEYTLSGAQDGFPFVFIHGTVGACCPNPTMS
AVCAAKGIRLITPSRPGYGASTRRQGRQVVDFVEDMKTLLDYLGVKRCVV
AGYSGGGPHGIACAARLPGCVAALVIAGGGPTDAEDLDYGASHGESNLEE
YEAMQKGEEAVREYCLKELPGMTQSDAKGLTEELSSILPEVDKKALLEND
SLAQYLVDQFQHGLGNGVDGWIDDDLELMQPWGFQLHEVRVPIHVYQGDL
DKMVPPSHGEWFATHLPEKYVKPHLLEGEGHISLYLKYMDEILDLVLTES
KA
metcm-a0a4q7js68: Pochonia chlamydosporia (123;170). AB hydrolase-1 domain-containing protein, 2 reference(s)Pochonia chlamydosporia 123 Show
MSQQLRLSDGRVLDYKISGAQDGFPLLWIHGTPGAYTVFSDLEGMCREKG
VKLITMSRAGYGSSTRQRGRCIVDVVPDLKQLTEHLNIKRCFVAGWSGGG
PHALACAAGLPGCVATLVIAGVGPWNAEDLDFLNGQGEDNVNEFNAALQG
EGATRQFCEGERPGMIKGDASDLVAAMSSILPDVDKKALLENDTLGQFLV
DNIREGLKVNSDGWIDDDLAFIQPWGFDLNEIKVPVLLYQGSEDKMVPFA
HGEWLAKHIPSEFCKAHLLQGQGHISIVLGQLEAMLDGLLQYR
metrr-a0a162jas4: Metarhizium rileyi (strain RCEF 4871) (Nomuraea rileyi). AB hydrolase-1 domain-containing protein, 1 reference(s)Metarhizium rileyi Show
MAQQLQLLDGRTLDYKLTGAPDGFPLFWIHGTPGAYTVFPDLEAVCSSKG
LKLITMTRAGYGGSTRQRRRSVVDIVKDIQQLAEHINAKRCFVAGWSGGG
PHALACAARLPGCVATLVIAGMAPWNAPGLDFLNGQGHENVREFRAALDG
EEELRGYCDSFRPGMMQSHVHDFVNAMSTLLPDVDNKAIHESNTLGQFLV
DNVQEGLKMSSDGWVDDDLAFIQPWGFELSEFKTPVLLYQGSDDGMVPFA
HGEWLAENIPYHLCRPRLLQGQGHVSILSTYLDDMVDGLLEYL
scyli-a0a3e2hij9: Scytalidium lignicola (Hyphomycete). AB hydrolase-1 domain-containing proteinScytalidium lignicola Show
MAQKLTLPDGRIAEYLVSGDTNGFPLVWIHGTPGAYQPVPSLVAASEKKG
VKVITISRAGYGSSSRNKGRSVVDAVADIQAVNEHLGVQRCLVGGWSGGG
PHALACAARLPGCVAALSVAGVGPYNVEGLDFLKGQGEDNVEEFNAALKG
EEELQKYCRAQREQLLQMDLAGITTALDSLFPEVDKKALATNGAMGQYIG
EGFHEALRVSADGWVDDDLAFTKPWGFELSEIKVPVFLYQGTEDKMVPYA
HGEWLAKQLPQDKVKKHLLPSEGHMSIFLGQEDLMIDELLEIAKL
spos1-u7pw92: Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus). AB hydrolase-1 domain-containing protein, 1 reference(s)Sporothrix schenckii Show
MAEQLFTLPDGRTIAYRVSGAPDGYPLVWFHGTPSSTEPPPALEAAAKKQ
GIRIIAAARPGYGGSGRHPGRRVVDAVADTQALNDFLGVRECLLMGWSGG
GPHALACAARLPGARAALTIAGVGPADAPDLDFLAGQGDDNVEEFRAAAA
GEPALRAFCDAMRSEIRAGGPAGVVAAFDTILSDVDKAATQDPANGLRDY
LFHVLDDGLHAGVDGWIDDDLEFTRPWGFDLAEIDVPVLLYQGSDDKMVP
YAHGQWFAKHLPAASLRAHLIEGEGHVSLVAKGAELLTELVAAGDVKVKQ
talmq-b6qv07: Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) (Penicillium marneffei). AB hydrolase-1 domain-containing protein, 1 reference(s)Talaromyces marneffei Show
MAQQFQQLQLPDGRNLDYCVNGPEDGIPLIFIHGTPSAGIPEPNLVSVCA
KKGIKVIGFSRAGYGGSTRNKGRQVVDSVADVKSLLDHLHAKKCFVAGWS
GEGPHALACAARLPGCLAVISFAGCAPYNIEGLDWLAGQGEDNIEEFNKA
LEGESQLRQFCEGHRKEYLASDLDGVMQVMSTLLPACDNATLIQNRDTIG
QNMVDALHEGLRLSADGWIDDDIEMLKPWGFELSEVRVPVLLYQGTEDKM
VPFAQGKWLSEHLPQDKVKPHLLEGHGHISIFDGIDGIIDELVAVVNL
talsn-b8mst3: Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum). Valacyclovir hydrolase, putative, 1 reference(s)Talaromyces stipitatus Show
MPQQFQQFQLPDGRNLDYCVNGPEDGIPLVWLHGTPSAGIPAPNLVTACA
KKGIKVIALSRPGYGGSSRNKGRQVVDTVADIKSLLNHLGVKKCLVGGWS
GGGPLTLACAARLPTCLAAVSFAGVGPYGVEGLDWWVGQGEDNVEEFSQA
LKGEPQLRQFCESHRKEFLQSDLDGVMEAMSTLLPPCDNATLIQNRDTIG
QNMIDMLQEGLKHNADGWVDDDLELLKPWGFELSEIRVPVVLLQGTEDKM
VPFGHGKWLAEHLPQDKVKAHLLEGHGHISIFEGIDRIIDELIAVANL
Sequences



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer