9bact-g1apt8

uncultured bacterium LipC12, a true lipase isolated through a metagenomics approach

Comment

Relationship

Family : Bacterial_lip_FamI.1

Block : L

Position in NCBI Life Tree : uncultured bacterium

Molecular evidence

No mutation

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSASSLKFPIVLVHGLLGFDKIGGIYPYFYGIKEALEKAG
AKVYIATLSA LNSNELRGEQLLEFVRKVQAETGAAKVNL
IGHSQGPLACRYVAATHPELI ASVTSVNGVNHGSEVADL
VRLALTPGRLPESIANAAMSAFGQLLSALAGS PRLPQSG
IEALEALTSEGVAAFNNKYPQGLPAEWGGEGKELVNGVYY
YSW SGVIDYNPLHQGANNLDPLHVAMLAFSILFTNERFQ
NDGLVGRYSSHLGK VIGSDYSMDHVDAINQLAGVVANNT
DPVQLFVEHVARLKSKGL

References

Title : Structure solution and analyses of the first true lipase obtained from metagenomics indicate potential for increased thermostability - Martini_2019_N.Biotechnol_53_65
Author(s) : Martini VP , Krieger N , Glogauer A , Souza EM , Iulek J
Ref : N Biotechnol , 53 :65 , 2019
Abstract : Martini_2019_N.Biotechnol_53_65
ESTHER : Martini_2019_N.Biotechnol_53_65
PubMedSearch : Martini_2019_N.Biotechnol_53_65
PubMedID: 31306784
Gene_locus related to this paper: 9bact-g1apt8

Title : Crystallization and preliminary crystallographic analysis of LipC12, a true lipase isolated through a metagenomics approach - Martini_2012_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_68_175
Author(s) : Martini VP , Glogauer A , Iulek J , Souza EM , Pedrosa FO , Krieger N
Ref : Acta Crystallographica Sect F Struct Biol Cryst Commun , 68 :175 , 2012
Abstract : Martini_2012_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_68_175
ESTHER : Martini_2012_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_68_175
PubMedSearch : Martini_2012_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_68_175
PubMedID: 22297992
Gene_locus related to this paper: 9bact-g1apt8

Title : Identification and characterization of a new true lipase isolated through metagenomic approach - Glogauer_2011_Microb.Cell.Fact_10_54
Author(s) : Glogauer A , Martini VP , Faoro H , Couto GH , Muller-Santos M , Monteiro RA , Mitchell DA , de Souza EM , Pedrosa FO , Krieger N
Ref : Microb Cell Fact , 10 :54 , 2011
Abstract : Glogauer_2011_Microb.Cell.Fact_10_54
ESTHER : Glogauer_2011_Microb.Cell.Fact_10_54
PubMedSearch : Glogauer_2011_Microb.Cell.Fact_10_54
PubMedID: 21762508
Gene_locus related to this paper: 9bact-g1apt8