9gamm-urc15994

Psychrobacter celer strain PU3 lipase

Comment

Relationship

Family : Bacterial_lip_FamI.1

Block : L

Position in NCBI Life Tree : Psychrobacter celer

Molecular evidence

No mutation

No structure

No kinetic

No disease

Database

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MTLSLYIRAALTPRTFLPILGSISTGVLLMTMQTISAQAA
GSFYNCANAT GCQKVDSKWWTSSHTDTKYPLVMTHGLVG
FTKLLGIDYFYGIPQTLMKGG SEVYATKTSSFNDSRVRG
EQLLRQVKTISAVSGSPKVNLLGHSHGGHDIR YVAGVAP
QYVASVTAVASPGQGAALADWVVEQIDNDRINGEYNTATK
AAL TLFGFLGDFMDLNAGIPIDELQDQDGFGAVTALTTD
YTKDFNREFSAAMP TSYCGQPTAIKVNGISYYSFSGVDQ
VTNVLDPTDYMMLATSQAYDDPNDG LVSACSSRLGYVIR
DDYKMNHLDSVNQLLGLVAWGQPNPKTVYRTQVNRL KNA
NL

References

Title : Functional and molecular characterization of a cold-active lipase from Psychrobacter celer PU3 with potential antibiofilm property - Esakkiraj_2022_Int.J.Biol.Macromol__
Author(s) : Esakkiraj P , Bharathi C , Ayyanna R , Jha N , Panigrahi A , Karthe P , Arul V
Ref : Int J Biol Macromol , : , 2022
Abstract : Esakkiraj_2022_Int.J.Biol.Macromol__
ESTHER : Esakkiraj_2022_Int.J.Biol.Macromol__
PubMedSearch : Esakkiraj_2022_Int.J.Biol.Macromol__
PubMedID: 35504418
Gene_locus related to this paper: 9gamm-urc15994