Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aroae-q5p1l8

Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) poly-beta-hydroxybutyrate polymerase (EC 2.3.1.-)

Relationship
Family|PHA_synth_I
Block| X
Position in NCBI Life Tree|Aromatoleum aromaticum EbN1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Rhodocyclales: N E > Rhodocyclaceae: N E > Aromatoleum: N E > Aromatoleum aromaticum: N E > Aromatoleum aromaticum EbN1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CR555306
1 UniProt : Q5P1L8
1 UniProt : Q5P1L8
1 Interpro : Q5P1L8
1 Pfam : Q5P1L8
1 PIRSF : Q5P1L8
1 SUPERFAM : Q5P1L8
Sequence
Graphical view for this peptide sequence: aroae-q5p1l8
Colored MSA for PHA_synth_I (raw)
MSDSEDKQQANAAAQGMLQFGQAMMQNFFDAVGRQQAAMQDSSGATVQRL
PLPEAEELSRMQQQFAERHAALWSALLQRKPGEQAAPIVEPPPGDRRFSS
PEWASSPVFDYVRQAYLLNSQFLKQVSDAVPMADGRAKSRVQFLTRQYID
ALAPSNFAATNPEFIKTALETKGESITKGLKNLIADLEKGRISMTDEAAF
EVGRNLAVTPGAVIHENELVQLIQYAPLTDKVAQVPLLIVPPSINKYYVL
DLQPENSLVRFAVEQGFTVFLVSWKNVGAEGGHFTWDDYVDKGVLTSLDV
VRAVTRVKKPNVLGFCVGGTILSAALAVARGRGEEPVESVTLMTTLLDFA
DAGELGCLVDEASVAAREAAIGKGGLLKGQELANVFSSLRANDLIWQYVV
GNYLKGNTPPPFDLLYWNSDSTNLPGPFLTWYLRNMYLENNLRVPGKLKV
LGVKLDLGKVDVPAYLLATREDHIVPWKGAYLSRGLLGGDTTFVLGASGH
IAGAINPASKNRRSFWVNPSTAADPDEWLEGAAERKGSWWLHWIEWLKLR
GGKQVAARGRIGNATYTPIEPAPGRYVKEKA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDSEDKQQANAAAQGMLQFGQAMMQNFFDAVGRQQAAMQDSSGATVQRL
PLPEAEELSRMQQQFAERHAALWSALLQRKPGEQAAPIVEPPPGDRRFSS
PEWASSPVFDYVRQAYLLNSQFLKQVSDAVPMADGRAKSRVQFLTRQYID
ALAPSNFAATNPEFIKTALETKGESITKGLKNLIADLEKGRISMTDEAAF
EVGRNLAVTPGAVIHENELVQLIQYAPLTDKVAQVPLLIVPPSINKYYVL
DLQPENSLVRFAVEQGFTVFLVSWKNVGAEGGHFTWDDYVDKGVLTSLDV
VRAVTRVKKPNVLGFCVGGTILSAALAVARGRGEEPVESVTLMTTLLDFA
DAGELGCLVDEASVAAREAAIGKGGLLKGQELANVFSSLRANDLIWQYVV
GNYLKGNTPPPFDLLYWNSDSTNLPGPFLTWYLRNMYLENNLRVPGKLKV
LGVKLDLGKVDVPAYLLATREDHIVPWKGAYLSRGLLGGDTTFVLGASGH
IAGAINPASKNRRSFWVNPSTAADPDEWLEGAAERKGSWWLHWIEWLKLR
GGKQVAARGRIGNATYTPIEPAPGRYVKEKA


Reference
    Title: The genome sequence of an anaerobic aromatic-degrading denitrifying bacterium, strain EbN1
    Rabus R, Kube M, Heider J, Beck A, Heitmann K, Widdel F, Reinhardt R
    Ref: Arch Microbiol, 183:27, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer