Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: metpp-a2scm2

Methylibium petroleiphilum (strain PM1) Putative lipase transmembrane protein

Relationship
Family|PGAP1
Block| X
Position in NCBI Life Tree|Methylibium petroleiphilum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > unclassified Burkholderiales: N E > Burkholderiales Genera incertae sedis: N E > Methylibium: N E > Methylibium petroleiphilum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000555
1 UniProt : A2SCM2
1 UniProt : A2SCM2
1 Interpro : A2SCM2
1 Pfam : A2SCM2
1 PIRSF : A2SCM2
1 SUPERFAM : A2SCM2
Sequence
Graphical view for this peptide sequence: metpp-a2scm2
Colored MSA for PGAP1 (raw)
MLARLQRLVILAVTLAALGWLVGWASEGRPVLAVAGALVLAFGYVFILAV
EFVLLACLHGRDETPRAGPLQLLRAWLGECVVAWQVFVWRQPFHAARYPD
VPGRPGVRGVVFVHGYVCNRGLWGPWLARCTAEQRPYVAVDLEPVFSDLD
IYVPQLEAAVARLEQSTGLPPLLVCHSMGGLVARAWLAATPGAATRVQHV
ITIGSPHRGTWLARLSRTTNSRHMRQASEWITGLAAREPALHTGRFTCFY
SHADNIVFPACAATLPGADNRHLPATAHVAMVFHPEVVSEAARWLAASSS
CVAGGASGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLARLQRLVILAVTLAALGWLVGWASEGRPVLAVAGALVLAFGYVFILAV
EFVLLACLHGRDETPRAGPLQLLRAWLGECVVAWQVFVWRQPFHAARYPD
VPGRPGVRGVVFVHGYVCNRGLWGPWLARCTAEQRPYVAVDLEPVFSDLD
IYVPQLEAAVARLEQSTGLPPLLVCHSMGGLVARAWLAATPGAATRVQHV
ITIGSPHRGTWLARLSRTTNSRHMRQASEWITGLAAREPALHTGRFTCFY
SHADNIVFPACAATLPGADNRHLPATAHVAMVFHPEVVSEAARWLAASSS
CVAGGASGR


Reference
    Title: Whole-genome analysis of the methyl tert-butyl ether-degrading beta-proteobacterium Methylibium petroleiphilum PM1
    Kane SR, Chakicherla AY, Chain PS, Schmidt R, Shin MW, Legler TC, Scow KM, Larimer FW, Lucas SM and Hristova KR <1 more author(s)>
    Ref: Journal of Bacteriology, 189:1931, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer