alifs-h1r1i6

Vibrio fischeri SR5. Esterase YqiA

Comment

Relationship

Family : abh_upf00227

Block : X

Position in NCBI Life Tree : Vibrio fischeri SR5

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MSKASLLLYIHGFNSSPLSHKAQVMAEYCKVHRPDIKVIV
PRLPSYPSQA AEYLIQLVEEYKDTYQIGLVGSSLGGYLS
TWLNHRYGFKAALVNPAVKPY ELLVDYLGKQINPYTQEE
YFLEEKHMAELFALQVETIHSVGDLWLLQQEG DEVLDYR
QAVDKYSACKQTIEKGGDHSFVNFERYPEQIIQFLNL

References

Title : Draft genome sequence of Vibrio fischeri SR5, a strain isolated from the light organ of the Mediterranean squid Sepiola robusta - Gyllborg_2012_J.Bacteriol_194_1639
Author(s) : Gyllborg MC , Sahl JW , Cronin DC, 3rd , Rasko DA , Mandel MJ
Ref : Journal of Bacteriology , 194 :1639 , 2012
Abstract : Gyllborg_2012_J.Bacteriol_194_1639
ESTHER : Gyllborg_2012_J.Bacteriol_194_1639
PubMedSearch : Gyllborg_2012_J.Bacteriol_194_1639
PubMedID: 22374964
Gene_locus related to this paper: vibf1-q5e481 , alifs-h1r1i6