clold-d8gsx2

Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC). Putative hydrolase

Comment

Relationship

Family : Proline_iminopeptidase

Block : X

Position in NCBI Life Tree : Clostridium ljungdahlii

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRNRNNRLICTSEYVSINGIDQFLYHLGTSFDNPVMLFLH
GGPGSAESLF TGLFQDRWEEIYTVVHWDQRGAGKTLTKN
PDKLPTIDLMLQDLFEVIQYL KKKYNKKKVVIFGHSWGS
VLGSIFIRKHPEEAEYYIGAGQVIGMVENEQV AYNKLKE
VIEQAGDKKSLKKLESVGEYPGSKIVFDKEFLRKCNIVHK
LLG KYKLGMEMGIDIWIAMFKSPIFKFSDIIAFMKIFKA
NSKVHSFLGDFNLR RESKEYKVPVYYILGERDWQAPRVV
AEDYFKDIKAPSKDIFIIPNAGHFL MMDQPDLVFDALSK
ISKKEKSRQYSNN

References

Title : Clostridium ljungdahlii represents a microbial production platform based on syngas - Kopke_2010_Proc.Natl.Acad.Sci.U.S.A_107_13087
Author(s) : Kopke M , Held C , Hujer S , Liesegang H , Wiezer A , Wollherr A , Ehrenreich A , Liebl W , Gottschalk G , Durre P
Ref : Proc Natl Acad Sci U S A , 107 :13087 , 2010
Abstract : Kopke_2010_Proc.Natl.Acad.Sci.U.S.A_107_13087
ESTHER : Kopke_2010_Proc.Natl.Acad.Sci.U.S.A_107_13087
PubMedSearch : Kopke_2010_Proc.Natl.Acad.Sci.U.S.A_107_13087
PubMedID: 20616070
Gene_locus related to this paper: clold-d8gi04 , clold-d8gqb1 , clold-d8gsx2 , clold-d8gue9