danpl-g6cm38

Danaus plexippus (Monarch butterfly) Uncharacterized protein

Comment

Relationship

Family : Carb_B_Arthropoda

Block : C

Position in NCBI Life Tree : Danaus plexippus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKRGRLCIFLMCAISLKKNPIVTVKQGKLRGESDLLFNGA
RYYSFKGIPY AAPPIGNLRFKAPQPPLPWKGIRDATKFG
SVCTQLNQTKVGEEDCLFLNV YTRSMNKNAKTPVILYIF
GGGFSYGSGSVYYGDFLLQHDVLLVTVNYRLE MLGFLSL
DIPEAPGNAGMKDQVAALRWIKDNIINFGGDPDNVTIFGD
SAA AGSVTFHMVSPMSRGLFHRAICQSGSFFNDWALAAD
KIKRAFRVGKILGK ETNDIYELYQYFMSLDKYKLTNVTL
SSMTYDEIYRGPPGQFIPAIEKEFP DVEAFLTEHPITIL
QKGNVAKVPLLIGYNNGEGLLYLNRYLESLAVYSKE PSY
FVGRYVANQVSPEKLEEFGKRIVRFYAGNKTLTKEDVNAL
TKIIGDT TYNYNIHRFINSYANFSHPIYMYKFHLDTELN
VAKVMFGVGHLKGASHGD ELWYLFKNFQNDYLYEKYLRL
RAIIYRVSKLWTDFAKTGEPISRNSDEEY WKPFTIKDKE
YYNIDDTFSMGYYADKERVEFWDEIYEEAGLPHIKSINVE
SDDTNLV