fusox-w9p5i8

Fusarium oxysporum f. sp. Uncharacterized protein

Comment

"Other strains: Fusarium oxysporum f. sp. (pisi HDV247\; raphani 54005\; melonis 26406)"

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Fusarium oxysporum f. sp. pisi HDV247

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MFLQLLSLLAPEIVFASYGPVKNPVVNLGSAGTYRGVLQN
NGTVESWKGI PYAQPPLGPLRFMPPEQLSHQSAAVVNAT
TNPDRCVQFTLAPYGVHNAYL GPGTPGTEDCLKLYVWKP
AKARKGNKLPVVVFVHGGGLIFGSGSQDDFGD WVSHDQK
FIAVSMNYRLGILGFLNHPDLPSANAGLLDQRLAMQWVKQ
NIA NFGGNPNDITIMGQSGGGWAILAHLALFDGHHNNTF
QKAIIRSAQREPMF NTEELKIRNKSLFNHVNCTTGQDQL
TCFRNLTESQLVTAFWSFSTVLGTE GIFKNQVFGYQGSF
GPTVDGVTLTDSVTKLFRKGKIANVPTTAGSTNDEG FDG
YVDAQQQNPTPKNTTKLDPSTNRITNLTDYQVNEVAKFYS
INATYAS LAPDNFFPNAFRAYWIALGLFGEVGIFGSERL
VGRWMSARHGPQWIWTYR FNAPRESAADRRLFIVILTVF
EAVGSVNPKWPYPLGPVTHSADNSYLDVR LNSMTSYERA
IAEEFRAYLSSFIRTGSPNTHKLHSAPFWPNYGALGDFFN
SPVRLVPQFAFSSNANKTYPTSTQIEVAQKAGLERTDYW
QTDKILDSIRF

References

Title : Genome Sequence of Fusarium oxysporum f. sp. melonis Strain NRRL 26406, a Fungus Causing Wilt Disease on Melon - Ma_2014_Genome.Announc_2_e00730
Author(s) : Ma LJ , Shea T , Young S , Zeng Q , Kistler HC
Ref : Genome Announc , 2 : , 2014
Abstract : Ma_2014_Genome.Announc_2_e00730
ESTHER : Ma_2014_Genome.Announc_2_e00730
PubMedSearch : Ma_2014_Genome.Announc_2_e00730
PubMedID: 25081257
Gene_locus related to this paper: fusox-a0a1d3s5h0 , fusox-w9p5i8 , fusox-w9hvf0