pethy-dad2

Petunia hybrida (Petunia) DAD2 ABHF7401 homologue to High tillering - Dwarf Dwarf88/HTD2

Comment

Relationship

Family : RsbQ-like

Block : X

Position in NCBI Life Tree : Petunia hybrida

Molecular evidence

No mutation

No kinetic

No disease

No substrate

Database

No Genbank

Sequence

Peptide

MGQTLLDALNVRVVGSGERVLVLAHGFGTDQSAWNRILPF
FLRDYRVVLY DLVCAGSVNPDFFDFRRYTTLDPYVDDLL
HILDALGIDCCAYVGHSVSAM IGILASIRRPELFSKLIL
IGASPRFLNDEDYHGGFEQGEIEKVFSAMEAN YEAWVNG
FAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSD
MRG VLGLVKVPCHIFQTARDHSVPASVATYLKNHLGGKN
TVHWLNIEGHLPHL SAPTLLAQELRRALSHR

References

Title : Flexibility of the petunia strigolactone receptor DAD2 promotes its interaction with signaling partners - Lee_2020_J.Biol.Chem_295_4181
Author(s) : Lee HW , Sharma P , Janssen BJ , Drummond RSM , Luo Z , Hamiaux C , Collier T , Allison JR , Newcomb RD , Snowden KC
Ref : Journal of Biological Chemistry , 295 :4181 , 2020
Abstract : Lee_2020_J.Biol.Chem_295_4181
ESTHER : Lee_2020_J.Biol.Chem_295_4181
PubMedSearch : Lee_2020_J.Biol.Chem_295_4181
PubMedID: 32071083
Gene_locus related to this paper: pethy-dad2

Title : Chemical synthesis and characterization of a new quinazolinedione competitive antagonist for strigolactone receptors with an unexpected binding mode - Hamiaux_2019_Biochem.J_476_1843
Author(s) : Hamiaux C , Larsen L , Lee HW , Luo Z , Sharma P , Hawkins BC , Perry NB , Snowden KC
Ref : Biochemical Journal , 476 :1843 , 2019
Abstract : Hamiaux_2019_Biochem.J_476_1843
ESTHER : Hamiaux_2019_Biochem.J_476_1843
PubMedSearch : Hamiaux_2019_Biochem.J_476_1843
PubMedID: 31186286
Gene_locus related to this paper: pethy-dad2

Title : Inhibition of strigolactone receptors by N-phenylanthranilic acid derivatives: Structural and functional insights - Hamiaux_2018_J.Biol.Chem_293_6530
Author(s) : Hamiaux C , Drummond RSM , Luo Z , Lee HW , Sharma P , Janssen BJ , Perry NB , Denny WA , Snowden KC
Ref : Journal of Biological Chemistry , 293 :6530 , 2018
Abstract : Hamiaux_2018_J.Biol.Chem_293_6530
ESTHER : Hamiaux_2018_J.Biol.Chem_293_6530
PubMedSearch : Hamiaux_2018_J.Biol.Chem_293_6530
PubMedID: 29523686
Gene_locus related to this paper: pethy-dad2

Title : DAD2 Is an alpha\/beta Hydrolase Likely to Be Involved in the Perception of the Plant Branching Hormone, Strigolactone - Hamiaux_2012_Curr.Biol_22_2032
Author(s) : Hamiaux C , Drummond RS , Janssen BJ , Ledger SE , Cooney JM , Newcomb RD , Snowden KC
Ref : Current Biology , 22 :2032 , 2012
Abstract : Hamiaux_2012_Curr.Biol_22_2032
ESTHER : Hamiaux_2012_Curr.Biol_22_2032
PubMedSearch : Hamiaux_2012_Curr.Biol_22_2032
PubMedID: 22959345
Gene_locus related to this paper: pethy-dad2