phavu-PvEH1

Phaseolus vulgaris (Kidney bean) (French bean) epoxide_hydrolase PvEH1

Comment

Relationship

Family : Epoxide_hydrolase

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSW
RHQILALSAL GYRAVAPDLRGYGDTDAPASVSSYTILHL
VADVVALIDSLGVDQVFLVAH DWGALVGWYTCLFRPDRI
KAYVCLSVPFMPRNPKVKPVDAMRALYGDDYI CRFQEPG
KMETLYDNNIEEAIKNMLTSRRPGPPILPKEGAGSNPLAS
GSL PSRPLPSWLSQEDLTYYASKFGKTGLTGGLNYYRNL
NLNWELTAAWTGVQ VKVPVKFITGDLDIVHTSLGTKDYI
ESGAFKRDVPFLEEVVVQEGVAHFN NQEAAEDVSNHIYD
FINKF

References

Title : Improving the activity and enantioselectivity of PvEH1, a Phaseolus vulgaris epoxide hydrolase, for o-methylphenyl glycidyl ether by multiple site-directed mutagenesis on the basis of rational design - Li_2019_Mol.Catal_476_110517
Author(s) : Li C , Kan T-T , Hu D , Wang T-T , Su Y-J , Zhang C , Cheng J-Q , Wu M-C
Ref : Molecular Catalysis , 476 :110517 , 2019
Abstract : Li_2019_Mol.Catal_476_110517
ESTHER : Li_2019_Mol.Catal_476_110517
PubMedSearch : Li_2019_Mol.Catal_476_110517
PubMedID:
Gene_locus related to this paper: phavu-PvEH1

Title : Substantially improving the enantioconvergence of PvEH1, a Phaseolus vulgaris epoxide hydrolase, towards m-chlorostyrene oxide by laboratory evolution - Zong_2019_Microb.Cell.Fact_18_202
Author(s) : Zong XC , Li C , Xu YH , Hu D , Hu BC , Zang J , Wu MC
Ref : Microb Cell Fact , 18 :202 , 2019
Abstract : Zong_2019_Microb.Cell.Fact_18_202
ESTHER : Zong_2019_Microb.Cell.Fact_18_202
PubMedSearch : Zong_2019_Microb.Cell.Fact_18_202
PubMedID: 31739786
Gene_locus related to this paper: phavu-PvEH1

Title : Directed modification of a novel epoxide hydrolase from Phaseolus vulgaris to improve its enantioconvergence towards styrene epoxides - Ye_2016_Catal.Commun_87_32
Author(s) : Ye HH , Hu D , Shi XL , Wu MC , Deng C , Li JF
Ref : Catalysis Communications , 87 :32 , 2016
Abstract : Ye_2016_Catal.Commun_87_32
ESTHER : Ye_2016_Catal.Commun_87_32
PubMedSearch : Ye_2016_Catal.Commun_87_32
PubMedID:
Gene_locus related to this paper: phavu-PvEH1