picp7-f2qwe3

Pichia pastoris (Yeast) UPF0613 protein PB24D3.06c

Comment

"Other strains: Pichia pastoris (strains ATCC 76273 \/ CBS 7435 \/ CECT 11047 \/ NRR Y-11430 \/ Wegner 21-1\; GS115 \/ ATCC 20864) (Yeast)"

Relationship

Family : Fusarinine_C_esterase_sidJ

Block : X

Position in NCBI Life Tree : Pichia pastoris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVEFTLQKSEPVTGIVHSIHTQIPPKAFEFVDSSFKDIVL
FVGGLTNGIL GVGYLPLLAKALAPLGFGLVQALLSSSDR
GWGTSSLKKDAAELAQLVKYL RTKAGKRNIILMGHSTGC
QDTIHYLLHQNPTEPTLRVNGAIFQAPVSDRE AFSNELP
VEELDALNEEARAILESKGPNELLPQKFRELAFNTPITAY
RWL SLMAQRGDDDYFSSYLTDEEFSNTLGAINVPFLLLY
SGSDEFVPQTVDSN KLVDRWKAIVQRNGLSDWSQYSGII
DGATHDLGPQSDAGVDRVVNFIKNL SWDKN

References

Title : High-quality genome sequence of Pichia pastoris CBS7435 - Kuberl_2011_J.Biotechnol_154_312
Author(s) : Kuberl A , Schneider J , Thallinger GG , Anderl I , Wibberg D , Hajek T , Jaenicke S , Brinkrolf K , Goesmann A , Szczepanowski R , Puhler A , Schwab H , Glieder A , Pichler H
Ref : J Biotechnol , 154 :312 , 2011
Abstract : Kuberl_2011_J.Biotechnol_154_312
ESTHER : Kuberl_2011_J.Biotechnol_154_312
PubMedSearch : Kuberl_2011_J.Biotechnol_154_312
PubMedID: 21575661
Gene_locus related to this paper: picp7-f2qwe3 , picpa-cbpy , picpa-KEX1 , picpg-c4qw07 , picpg-c4r0k6 , picpg-c4r5w7 , picpg-c4r6t8 , picpg-c4r272 , picpg-c4r403 , picpg-c4r663 , picpg-c4r788 , picpa-a0a1b2jh35

Title : Genome sequence of the recombinant protein production host Pichia pastoris - De Schutter_2009_Nat.Biotechnol_27_561
Author(s) : De Schutter K , Lin YC , Tiels P , Van Hecke A , Glinka S , Weber-Lehmann J , Rouze P , Van de Peer Y , Callewaert N
Ref : Nat Biotechnol , 27 :561 , 2009
Abstract : De Schutter_2009_Nat.Biotechnol_27_561
ESTHER : De Schutter_2009_Nat.Biotechnol_27_561
PubMedSearch : De Schutter_2009_Nat.Biotechnol_27_561
PubMedID: 19465926
Gene_locus related to this paper: picp7-f2qwe3 , picpa-c1phg5 , picpa-cbpy , picpa-KEX1 , picpg-c4qw07 , picpg-c4r0k6 , picpg-c4r1s0 , picpg-c4r4a5 , picpg-c4r5w7 , picpg-c4r6t8 , picpg-c4r7h5 , picpg-c4r029 , picpg-c4r272 , picpg-c4r403 , picpg-c4r663 , picpg-c4r788 , picpa-a0a1b2jh35