rhiro-a0a2k6nnj4

Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana). Uncharacterized protein

Comment

Relationship

Family : Arb2_FAM172A

Block : X

Position in NCBI Life Tree : Rhinopithecus roxellana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSR
IDLDELMKKD EPPLDFPDTLEGFEYAFNEKGQLRHIKTG
EPFVFNYREDLHRWNQKRYEA LGEIITKYVYELLEKDCN
LKKISIPVDATESEPKSFIFMSEDALTNPQKL MVLIHGS
GVVRAGQWARRLIINEDLDSGTQIPFIKRAVAEGYGVIVL
NPN ENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKE
TKKRRDFYEKYRNP QREKEMMQLYIRENGSPEEHAIYVW
DHFIAQAAAENVFFVAHSYGGLAFV ELMIQREADVKNKV
TAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSS EPL
DTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEAS
EAKISSL KPAVTRRSHRIKHEEL

References