strcj-estA

Streptomyces cinnamoneus (Streptoverticillium cinnamoneum) estA, R18 Feruoyl esterase strain: NBRC 12852 R18

Comment

"BAS50192 only 94\% identical"

Relationship

Family : PAF-Acetylhydrolase

Block : X

Position in NCBI Life Tree : Streptomyces cinnamoneus

Molecular evidence

No mutation

No kinetic

No disease

No inhibitor

Database

Sequence

Peptide

MIMISSMRKTSRRSFVAAALLAAFAAPQVPAAAAAAPAAA
PATAGQEVPA PATRIPLGTKTLHLVDASRQDPWKPSAGN
RELMVTLWYPSLPSREPAAPY VSKPLSRAVLGNDVLAGV
RTHAVAGARPAPVPRPLVVLSPGFGMSRITLT ALGEDLA
SRGYAVAAVDHTYEAPVEFPGGRIEKCTLCDDSRMDPGAV
VRN RAKDLRFVLDRLTGPGSELRVDARRIGVAGHSIGGA
SAVEVMREDRRVDA AINLDGNFFTEPPAEGLNKPVLLLG
ARRSGLPEPQENWERAWKQLTGWKR WLDVPAGGHMTFTD
VPWIVDRFGMPGQIPPEQVEGQLGTVSAARATAVTR NYV
AAFFDRHLRGRPSPLLDRPSSAHPEVTFMK

References

Title : Enhancing the secretion of a feruloyl esterase in Bacillus subtilis by signal peptide screening and rational design - Liu_2022_Protein.Expr.Purif__106165
Author(s) : Liu P , Guo J , Miao L , Liu H
Ref : Protein Expr Purif , :106165 , 2022
Abstract : Liu_2022_Protein.Expr.Purif__106165
ESTHER : Liu_2022_Protein.Expr.Purif__106165
PubMedSearch : Liu_2022_Protein.Expr.Purif__106165
PubMedID: 36038098
Gene_locus related to this paper: strcj-estA

Title : Loop of Streptomyces Feruloyl Esterase Plays an Important Role in the Enzyme's Catalyzing the Release of Ferulic Acid from Biomass - Uraji_2018_Appl.Environ.Microbiol_84_
Author(s) : Uraji M , Tamura H , Mizohata E , Arima J , Wan K , Ogawa K , Inoue T , Hatanaka T
Ref : Applied Environmental Microbiology , 84 : , 2018
Abstract : Uraji_2018_Appl.Environ.Microbiol_84_
ESTHER : Uraji_2018_Appl.Environ.Microbiol_84_
PubMedSearch : Uraji_2018_Appl.Environ.Microbiol_84_
PubMedID: 29150515
Gene_locus related to this paper: strcj-estA

Title : Application of two newly identified and characterized feruloyl esterases from Streptomyces sp. in the enzymatic production of ferulic acid from agricultural biomass - Uraji_2014_PLoS.One_9_e104584
Author(s) : Uraji M , Arima J , Inoue Y , Harazono K , Hatanaka T
Ref : PLoS ONE , 9 :e104584 , 2014
Abstract : Uraji_2014_PLoS.One_9_e104584
ESTHER : Uraji_2014_PLoS.One_9_e104584
PubMedSearch : Uraji_2014_PLoS.One_9_e104584
PubMedID: 25093500
Gene_locus related to this paper: strcj-estA , strcj-estB