vibf1-q5e426

Vibrio fischeri (strain ATCC 700601 / ES114) secretory tripeptidyl aminopeptidase (EC 3.4.11.-)

Comment

Relationship

Family : AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Vibrio fischeri

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MARFKHLLGLLIIFSPFSSLAAATTADEQLSFESTSNEEK
PSRNGIYSLK VPKNHKNPDGEKVDIYYFFHKATSESDRI
GLLFFNFGGPGADAIGEAKYT IQDLPVSITKSFDLIFLD
PRGTGKSAFADKIRKYANEVRKCKEKQTCDTD AFIKDIA
LPYDAFIKDIAPYMGTNAVADDMDALREHLGEDKISYLGY
SYG TRLGSIYAERYPDRIRAAVLDSAMSPIFENERGLSI
DLAKNHEKIAEYRL NYRFERLEKLRNIVSIVRNESNYQT
NDGYSFDKEKIYTLLYFLVEKDNED SIDWFKSKKYAAIT
KLLDTDEGKDFHDIYIQEQKKQQEQQEQSTMGFVYP IVS
CTDEITPLTNEEISNEDKYWQSSMIYGGFLFELFQTCLNW
KAERSPI ASADDINRNISSNILIIGGRYDPNTAYNWAED
MHKTIKSSTLITVDGYNS VQHGFSFSGTKCVDKITTEYL
FNPSKKISDTTCKRSPPNNLMSSPKNWRE RIEYEPLSKP

References

Title : Complete genome sequence of Vibrio fischeri: a symbiotic bacterium with pathogenic congeners - Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
Author(s) : Ruby EG , Urbanowski M , Campbell J , Dunn A , Faini M , Gunsalus R , Lostroh P , Lupp C , McCann J , Millikan D , Schaefer A , Stabb E , Stevens A , Visick K , Whistler C , Greenberg EP
Ref : Proc Natl Acad Sci U S A , 102 :3004 , 2005
Abstract : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
ESTHER : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
PubMedSearch : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
PubMedID: 15703294
Gene_locus related to this paper: vibf1-bioh , vibf1-q5dyj8 , vibf1-q5dz04 , vibf1-q5dzd4 , vibf1-q5e0d6 , vibf1-q5e0p3 , vibf1-q5e1x0 , vibf1-q5e2m2 , vibf1-q5e5q9 , vibf1-q5e5s9 , vibf1-q5e6n7 , vibf1-q5e6w2 , vibf1-q5e8d5 , vibf1-q5e187 , vibf1-q5e426 , vibf1-q5e436 , vibf1-q5e442 , vibf1-q5e481 , vibf1-q5e757