vibf1-q5e5s9

Vibrio fischeri (strain ATCC 700601 / ES114) prolyl endopeptidase (EC 3.4.21.26)

Comment

Relationship

Family : S9N_PPCE_Peptidase_S9

Block : X

Position in NCBI Life Tree : Vibrio fischeri

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MIYPFTKQDSTVDHYFSHAIADPYRWLEDDRSEETEAWVN
KQNDVTFDYL SHIDFRDDIRDLIAKGQDYQKTSQPFKRG
EYTYFYQNDGLQNQSVLYRSK EGKDVEVFLDPNTFSEEG
TTSLSVVSFSKDASLVAYSISEAGSDWRKIIV LDAETKE
QIEAPIVDAKFTGISWLGSKGFYYSSYDKPEGSELSARTE
QHK LYFHEIGKPQADDVLVFGGSEEEKHRYVSGYTTEDD
AYLVISASTSTSGN KLFIEPLNRDSSYRLTVLDHTDSDT
YVIENEDTHLLMFTNLNAPNGKVVS YDVVTGEWTDIIPE
QPQPLDISVGGGTLFATYMVDVLSQVKQYDFSGNLL REI
ELPGEGQATGFSGKREQTDLFFTFTNYVTPPTIYQFDVKT
GETELYL ASASPFDSEKFESKQVFYTSKDGTQIPMLISY
RKGIELDGSNPTILYGYG GFNVSLTPNFSGVMASWLELG
GVYAIPNIRGGGEYGKEWHKAGTQQQKQN VFDDFIAAAE
FLIAEKYTDSSRLAIRGGSNGGLLVGACMTQRPELFKVAL
PAVGVLDMLRYHTFTSGEGWAYDYGTSEQSEEMFNYLLN
YSPVHNVKEGV EYPATLVTTADHDDRVVPAHSYKFISEL
QAKQSGDNPVLIRIDVNAGHGA GMPISKSMDLMADVYAF
TLSNMKVNPFE

References

Title : Complete genome sequence of Vibrio fischeri: a symbiotic bacterium with pathogenic congeners - Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
Author(s) : Ruby EG , Urbanowski M , Campbell J , Dunn A , Faini M , Gunsalus R , Lostroh P , Lupp C , McCann J , Millikan D , Schaefer A , Stabb E , Stevens A , Visick K , Whistler C , Greenberg EP
Ref : Proc Natl Acad Sci U S A , 102 :3004 , 2005
Abstract : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
ESTHER : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
PubMedSearch : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
PubMedID: 15703294
Gene_locus related to this paper: vibf1-bioh , vibf1-q5dyj8 , vibf1-q5dz04 , vibf1-q5dzd4 , vibf1-q5e0d6 , vibf1-q5e0p3 , vibf1-q5e1x0 , vibf1-q5e2m2 , vibf1-q5e5q9 , vibf1-q5e5s9 , vibf1-q5e6n7 , vibf1-q5e6w2 , vibf1-q5e8d5 , vibf1-q5e187 , vibf1-q5e426 , vibf1-q5e436 , vibf1-q5e442 , vibf1-q5e481 , vibf1-q5e757