vibf1-q5e1x0

Vibrio fischeri (strains ATCC 700601 / ES114; MJ11) lysophospholipase l2 (EC 3.1.1.5)

Comment

"only c-term Pfam A Abhydrolase_6 54 309"

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Vibrio fischeri

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

AIMVVNGRIESVYKYQELFYDLFCQGYDIYSFDHRGQGLS
DRLTDNNDIG HIEDFNDYVLDLNSLTQSLITPEHYQDCY
LLGHSMGGAIATQYIETHSHP YTALALSAPMHGIHMQPW
LKPIANPISRYLSLWSKQPSYALGQAPYHAKP FLDNALT
TCEIRYQWFRELYDTKPELQIGGPSNHWVNQGLKGAKLCV
DQA AQCTLPTLLLQGEKDQIVDNNAHVKFQKKAPDCQLI
TISDAKHELLFETD ECRNQALVAIIDFFQQHSHV

References

Title : Complete genome sequence of Vibrio fischeri: a symbiotic bacterium with pathogenic congeners - Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
Author(s) : Ruby EG , Urbanowski M , Campbell J , Dunn A , Faini M , Gunsalus R , Lostroh P , Lupp C , McCann J , Millikan D , Schaefer A , Stabb E , Stevens A , Visick K , Whistler C , Greenberg EP
Ref : Proc Natl Acad Sci U S A , 102 :3004 , 2005
Abstract : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
ESTHER : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
PubMedSearch : Ruby_2005_Proc.Natl.Acad.Sci.U.S.A_102_3004
PubMedID: 15703294
Gene_locus related to this paper: vibf1-bioh , vibf1-q5dyj8 , vibf1-q5dz04 , vibf1-q5dzd4 , vibf1-q5e0d6 , vibf1-q5e0p3 , vibf1-q5e1x0 , vibf1-q5e2m2 , vibf1-q5e5q9 , vibf1-q5e5s9 , vibf1-q5e6n7 , vibf1-q5e6w2 , vibf1-q5e8d5 , vibf1-q5e187 , vibf1-q5e426 , vibf1-q5e436 , vibf1-q5e442 , vibf1-q5e481 , vibf1-q5e757