Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bace-b3cet1

Bacteroides intestinalis DSM 17393 Bacint_04212 BiFae1A ferulic acid esterase

Relationship
Family|A85-Feruloyl-Esterase
Block| X
Position in NCBI Life Tree|Bacteroides intestinalis DSM 17393
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Bacteroidaceae: N E > Bacteroides: N E > Bacteroides intestinalis: N E > Bacteroides intestinalis DSM 17393: N E


Molecular evidence
Database
No mutation
1 structure:
5VOL: Bacint_04212 BiFae1A ferulic acid esterase
No kinetic





2 substrates: Methyl-ferulate, Paranitrophenylacetate
No inhibitor
1 Genbank : ABJL02000008
1 UniProt : B3CET1
1 Structure : 5VOL
1 UniProt : B3CET1
1 Interpro : B3CET1
1 Prodom : B3CET1
1 Pfam : B3CET1
1 PIRSF : B3CET1
1 SUPERFAM : B3CET1
Sequence
Graphical view for this peptide sequence: 9bace-b3cet1
Colored MSA for A85-Feruloyl-Esterase (raw)
MMKKIIVWLAVMMYTLSGYAQNAPWNFQSKVVTDTLFSKVLNSKRAYTVF
LPKSFEQNKEKKYPVLYLLHGMWETNPVWAERGHVKDVMDRLVASGEACE
MIIVTPNAGGNIHLEWNGYFDMPGWKYETFFYTEFLPYIEKKYRVIGDRQ
HRAIAGLSMGGGGATNYGQRHSDMFCAVYAMSALMSIPEQGAVPADDPNS
KIAILTRSVIENSCVKYVMEADEDRKADLRSVAWFVDCGDDDFLLDRNIE
FYQAMRNAGVPCQFRVRDGGHDWEYWHSALYQCLPFVTRIFGKE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKKIIVWLAVMMYTLSGYAQNAPWNFQSKVVTDTLFSKVLNSKRAYTVF
LPKSFEQNKEKKYPVLYLLHGMWETNPVWAERGHVKDVMDRLVASGEACE
MIIVTPNAGGNIHLEWNGYFDMPGWKYETFFYTEFLPYIEKKYRVIGDRQ
HRAIAGLSMGGGGATNYGQRHSDMFCAVYAMSALMSIPEQGAVPADDPNS
KIAILTRSVIENSCVKYVMEADEDRKADLRSVAWFVDCGDDDFLLDRNIE
FYQAMRNAGVPCQFRVRDGGHDWEYWHSALYQCLPFVTRIFGKE


Reference
    Title: Biochemical and Structural Analyses of Two Cryptic Esterases in Bacteroides intestinalis and their Synergistic Activities with Cognate Xylanases
    Wefers D, Cavalcante JJV, Schendel RR, Deveryshetty J, Wang K, Wawrzak Z, Mackie RI, Koropatkin NM, Cann I
    Ref: Journal of Molecular Biology, 429:2509, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer