Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9baci-w4vi05

Gracilibacillus boraciitolerans JCM 21714. Carboxylesterase

Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Gracilibacillus boraciitolerans JCM 21714
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Gracilibacillus: N E > Gracilibacillus boraciitolerans: N E > Gracilibacillus boraciitolerans JCM 21714: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BAVS01000007
1 UniProt : W4VI05
1 UniProt : W4VI05
1 Interpro : W4VI05
1 Prodom : W4VI05
1 Pfam : W4VI05
1 PIRSF : W4VI05
1 SUPERFAM : W4VI05
Sequence
Graphical view for this peptide sequence: 9baci-w4vi05
Colored MSA for CarbLipBact_1 (raw)
MINIIIYNSLILIGKDIFEMKIKQPESFMFKGGDDRAVLLLHGFTGHSAD
VRMLGRYLNGKGYTCYAPIYRGHGKSPEDLIGATADQWWEDVQYAYKYLQ
EKGYQKIAVAGLSLGGVLGLKLACNNPIKGVVTMSSPMFFDNEEQLTVGF
RQFAKEYKQLEKKEEDIIEQEVTDLLNESKELFQQIERSITDVKENVDML
YTPILVLQASKDQMINPESANYIYEHVASNNKQLIWYKNAGHALTFSNVK
DQVQEDIEEFFASLDW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MINIIIYNSLILIGKDIFEMKIKQPESFMFKGGDDRAVLLLHGFTGHSAD
VRMLGRYLNGKGYTCYAPIYRGHGKSPEDLIGATADQWWEDVQYAYKYLQ
EKGYQKIAVAGLSLGGVLGLKLACNNPIKGVVTMSSPMFFDNEEQLTVGF
RQFAKEYKQLEKKEEDIIEQEVTDLLNESKELFQQIERSITDVKENVDML
YTPILVLQASKDQMINPESANYIYEHVASNNKQLIWYKNAGHALTFSNVK
DQVQEDIEEFFASLDW


Reference
    Title: Draft Genome Sequence of the Boron-Tolerant and Moderately Halotolerant Bacterium Gracilibacillus boraciitolerans JCM 21714T
    Ahmed I, Oshima K, Suda W, Kitamura K, Iida T, Ohmori Y, Fujiwara T, Hattori M, Ohkuma M
    Ref: Genome Announc, 2:, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer