Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bacl-7ACAaes

Paenibacillus campinasensis; Paenibacillus sp. XW-6-66 acetyl esterase 7-aminocephalosporanic acid deacetylase AesZY

Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Paenibacillus campinasensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Paenibacillaceae: N E > Paenibacillus: N E > Paenibacillus campinasensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: 7-Aminocephalosporanic-acid, Cephalosporin-C
No inhibitor
1 Genbank : WP_095263042
1 UniProt : A0A268F4F1
1 UniProt : A0A268F4F1
1 Interpro : A0A268F4F1
1 Prodom : A0A268F4F1
1 Pfam : A0A268F4F1
1 PIRSF : A0A268F4F1
1 SUPERFAM : A0A268F4F1
Sequence
Graphical view for this peptide sequence: 9bacl-7ACAaes
Colored MSA for BD-FAE (raw)
MKLWENIQQTPGYEPGEGAFVPEITPYLIEDGVVRGAVLVLPGGGYRLRA
DHEGEPVAKWLNSIGLSAFVVHYRVSPYQHPYPLLDAKRAIRLVRYHAQE
WNIDQNRIGILGFSAGGHLAACASTHFDKGDPEASDPVERESSRPDISVL
CYPVISFKQFTHEGSVSHLLGDHPTEALRRELSGELAVQPNTPPAFLWHT
ADDSAVPVENSLLYAGALSKHHIPFGLHVFPHGRHGLGLAEDVPDVSRWT
SLCEEWLRTIGYLKE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLWENIQQTPGYEPGEGAFVPEITPYLIEDGVVRGAVLVLPGGGYRLRA
DHEGEPVAKWLNSIGLSAFVVHYRVSPYQHPYPLLDAKRAIRLVRYHAQE
WNIDQNRIGILGFSAGGHLAACASTHFDKGDPEASDPVERESSRPDISVL
CYPVISFKQFTHEGSVSHLLGDHPTEALRRELSGELAVQPNTPPAFLWHT
ADDSAVPVENSLLYAGALSKHHIPFGLHVFPHGRHGLGLAEDVPDVSRWT
SLCEEWLRTIGYLKE


Reference
    Title: Identification and characterization of an acetyl esterase from Paenibacillus sp. XW-6-66 and its novel function in 7-aminocephalosporanic acid deacetylation
    Ding J, Zhou Y, Zhu H, Deng M, Long L, Yang Y, Wu Q, Huang Z
    Ref: Biotechnol Lett, 41:1059, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer