Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-TtEst

Thermogutta terrifontis thermophilic esterase from a new Planctomycetes species

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Thermogutta terrifontis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Planctomycetes: N E > Planctomycetia: N E > Planctomycetales: N E > Planctomycetaceae: N E > Thermogutta: N E > Thermogutta terrifontis: N E


Molecular evidence
Database
No mutation
5 structures (e.g. : 4UHC, 4UHD, 4UHE... more)
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A0M3KKY6
>3 Structure links 2 more: 4UHC, 4UHD, 4UHE
1 UniProt : A0A0M3KKY6
1 Interpro : A0A0M3KKY6
1 Prodom : A0A0M3KKY6
1 Pfam : A0A0M3KKY6
1 PIRSF : A0A0M3KKY6
1 SUPERFAM : A0A0M3KKY6
Sequence
Graphical view for this peptide sequence: 9bact-TtEst
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MAQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELC
DEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGL
SMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREG
PGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAER
PDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGH
LPPMEQPERVTQAIREWLRKVHTEAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELC
DEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGL
SMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREG
PGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAER
PDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGH
LPPMEQPERVTQAIREWLRKVHTEAG


References
    Title: Identification of lipases with activity towards monoacylglycerol by criterion of conserved cap architectures
    Riegler-Berket L, Leitmeier A, Aschauer P, Dreveny I, Oberer M
    Ref: Biochimica & Biophysica Acta, 1863:679, 2018 : PubMed

            

    Title: Structural studies of a thermophilic esterase from a new Planctomycetes species, Thermogutta terrifontis
    Sayer C, Isupov MN, Bonch-Osmolovskaya E, Littlechild JA
    Ref: Febs J, 282:2846, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer