Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-i6azi1

Opitutaceae bacterium TAV1. Uncharacterized protein

Relationship
Family|Abhydrolase_7
Block| X
Position in NCBI Life Tree|Opitutaceae bacterium TAV1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Opitutae: N E > Opitutales: N E > Opitutaceae: N E > unclassified Opitutaceae: N E > Opitutaceae bacterium TAV1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : JH660698, WP_007363378
1 UniProt : I6AZI1
1 UniProt : I6AZI1
1 Interpro : I6AZI1
1 Pfam : I6AZI1
1 PIRSF : I6AZI1
1 SUPERFAM : I6AZI1
Sequence
Graphical view for this peptide sequence: 9bact-i6azi1
Colored MSA for Abhydrolase_7 (raw)
MTSCIRKNFFLPVAFLCAALFTCAPQSALVAAPKAEGKECSAAFSAALAV
PREEMLASMRAGLFPTPAEVPAPSYEITEKTDAGDHERWKLRYTVDKDET
VTAWLIVPKPLPAAGTRLPLVLALHPTNDAGKDRVLGLYEKPPADEKERV
HRENRAYGLDLVRRGFVVFAPDRAGYGERRLLASGAFKEQMAASQRALRK
THPGWGLVGKAIWDLQRALDFLVTLDFVDPQRIGSVGHSLGAWDTVILGA
LDDRIRAIAVSHCGSLRFRPELWSDETALRAFLEDGKKKSAGINTNLNIY
LMLLAPRSQLFFWSMLEPKDAPPNLVDALRVVSAFSQQVAQASGTALDFS
FYLHTAGHDFPPDSRALAWEWFETRLKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSCIRKNFFLPVAFLCAALFTCAPQSALVAAPKAEGKECSAAFSAALAV
PREEMLASMRAGLFPTPAEVPAPSYEITEKTDAGDHERWKLRYTVDKDET
VTAWLIVPKPLPAAGTRLPLVLALHPTNDAGKDRVLGLYEKPPADEKERV
HRENRAYGLDLVRRGFVVFAPDRAGYGERRLLASGAFKEQMAASQRALRK
THPGWGLVGKAIWDLQRALDFLVTLDFVDPQRIGSVGHSLGAWDTVILGA
LDDRIRAIAVSHCGSLRFRPELWSDETALRAFLEDGKKKSAGINTNLNIY
LMLLAPRSQLFFWSMLEPKDAPPNLVDALRVVSAFSQQVAQASGTALDFS
FYLHTAGHDFPPDSRALAWEWFETRLKK


Reference
    Title: High-quality draft genome sequence of the Opitutaceae bacterium strain TAV1, a symbiont of the wood-feeding termite Reticulitermes flavipes
    Isanapong J, Goodwin L, Bruce D, Chen A, Detter C, Han J, Han CS, Held B, Huntemann M and Rodrigues JL <10 more author(s)>
    Ref: Journal of Bacteriology, 194:2744, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer