Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-k2age0

uncultured bacterium. Uncharacterized protein

Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AMFJ01021501
1 UniProt : K2AGE0
1 UniProt : K2AGE0
1 Interpro : K2AGE0
1 Pfam : K2AGE0
1 PIRSF : K2AGE0
1 SUPERFAM : K2AGE0
Sequence
Graphical view for this peptide sequence: 9bact-k2age0
Colored MSA for CarbLipBact_2 (raw)
MVKGIAKFAGKVAGKARDILFADPKLLYQEERHLVDKSFFWQGTNGKGVL
LVHGWTSTPYEVRRLGKYLNENGYTVSGILLSGHGTVPKDLEEIKWQQWV
GDVRTGVDELKKNCDKVYIAGTSIGSNLAVLVALEQAGISGLVLMAMPYK
MRVEKIGFFIANMLVKMGVKYRKKFYPPTFGLSTTITRVISYQTYPIASA
LESFEVIKASRENIGKVTQPCLIMQSTHDHMVAKGNLERIYDNIGSKIKT
KKYIQKAYHTFISDIKNEHVFEDILRFLEDN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVKGIAKFAGKVAGKARDILFADPKLLYQEERHLVDKSFFWQGTNGKGVL
LVHGWTSTPYEVRRLGKYLNENGYTVSGILLSGHGTVPKDLEEIKWQQWV
GDVRTGVDELKKNCDKVYIAGTSIGSNLAVLVALEQAGISGLVLMAMPYK
MRVEKIGFFIANMLVKMGVKYRKKFYPPTFGLSTTITRVISYQTYPIASA
LESFEVIKASRENIGKVTQPCLIMQSTHDHMVAKGNLERIYDNIGSKIKT
KKYIQKAYHTFISDIKNEHVFEDILRFLEDN


Reference
    Title: Fermentation, hydrogen, and sulfur metabolism in multiple uncultivated bacterial phyla
    Wrighton KC, Thomas BC, Sharon I, Miller CS, Castelle CJ, VerBerkmoes NC, Wilkins MJ, Hettich RL, Lipton MS and Banfield JF <2 more author(s)>
    Ref: Science, 337:1661, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer