Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9cyan-d0e8e2

Lyngbya majuscula 19L Polyketide synthase

Comment
only a little C-terminal 1979-2036 part homologous to ab-hydrolases. In Gu et al. the sequence is corrected because Q6DNE0 may have been partially replaced with exogenous DNA during construction of the genomic library


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Lyngbya majuscula 19L
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Oscillatoriaceae: N E > Moorea: N E > Moorea producens: N E > Moorea producens 19L: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3QIT: Thioesterase Domain From Curacin Biosynthetic Pathway
No kinetic





No Substrate
No inhibitor
2 Genbank : GQ412749, AY652953
3 UniProt : D0E8E2, Q6DNE0, A0A1D8TZ75
1 Structure : 3QIT
3 UniProt : D0E8E2, Q6DNE0, A0A1D8TZ75
3 Interpro : D0E8E2, Q6DNE0, A0A1D8TZ75
3 Prodom : D0E8E2, Q6DNE0, A0A1D8TZ75
3 Pfam : D0E8E2, Q6DNE0, A0A1D8TZ75
3 PIRSF : D0E8E2, Q6DNE0, A0A1D8TZ75
3 SUPERFAM : D0E8E2, Q6DNE0, A0A1D8TZ75
Sequence
Graphical view for this peptide sequence: 9cyan-d0e8e2
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MEEKFLEFGGNQICLCSWGSPEHPVVLCIHGILEQGLAWQEVALPLAAQG
YRVVAPDLFGHGRSSHLEMVTSYSSLTFLAQIDRVIQELPDQPLLLVGHS
MGAMLATAIASVRPKKIKELILVELPLPAEESKKESAVNQLTTCLDYLSS
TPQHPIFPDVATAASRLRQAIPSLSEEFSYILAQRITQPNQGGVRWSWDA
IIRTRSILGLNNLPGGRSQYLEMLKSIQVPTTLVYGDSSKLNRPEDLQQQ
KMTMTQAKRVFLSGGHNLHIDAAAALASLILTS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEEKFLEFGGNQICLCSWGSPEHPVVLCIHGILEQGLAWQEVALPLAAQG
YRVVAPDLFGHGRSSHLEMVTSYSSLTFLAQIDRVIQELPDQPLLLVGHS
MGAMLATAIASVRPKKIKELILVELPLPAEESKKESAVNQLTTCLDYLSS
TPQHPIFPDVATAASRLRQAIPSLSEEFSYILAQRITQPNQGGVRWSWDA
IIRTRSILGLNNLPGGRSQYLEMLKSIQVPTTLVYGDSSKLNRPEDLQQQ
KMTMTQAKRVFLSGGHNLHIDAAAALASLILTS


References
    Title: Terminal alkene formation by the thioesterase of curacin A biosynthesis: structure of a decarboxylating thioesterase
    Gehret JJ, Gu L, Gerwick WH, Wipf P, Sherman DH, Smith JL
    Ref: Journal of Biological Chemistry, 286:14445, 2011 : PubMed

            

    Title: Polyketide decarboxylative chain termination preceded by o-sulfonation in curacin a biosynthesis
    Gu L, Wang B, Kulkarni A, Gehret JJ, Lloyd KR, Gerwick L, Gerwick WH, Wipf P, Hakansson K and Sherman DH <1 more author(s)>
    Ref: Journal of the American Chemical Society, 131:16033, 2009 : PubMed

            

    Title: Biosynthetic pathway and gene cluster analysis of curacin A, an antitubulin natural product from the tropical marine cyanobacterium Lyngbya majuscula
    Chang Z, Sitachitta N, Rossi JV, Roberts MA, Flatt PM, Jia J, Sherman DH, Gerwick WH
    Ref: Journal of Natural Products, 67:1356, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer