Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9dipt-Boest1

Bradysia odoriphaga esterase HA402_007762 Boest1

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Bradysia odoriphaga
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Bibionomorpha: N E > Sciaroidea: N E > Sciaridae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Malathion, trans-Bifenthrin
No inhibitor
2 Genbank : KAG4068242, MZ725528
1 UniProt : A0A8J5A7Z4
1 UniProt : A0A8J5A7Z4
1 Interpro : A0A8J5A7Z4
1 Prodom : A0A8J5A7Z4
1 Pfam : A0A8J5A7Z4
1 PIRSF : A0A8J5A7Z4
1 SUPERFAM : A0A8J5A7Z4
Sequence
Graphical view for this peptide sequence: 9dipt-Boest1
Colored MSA for Carb_B_Arthropoda (raw)
MDNNCIVQTEYGKVRGFLQMSLVDIPYIRFLGIPYAKPPVGNLRFKSPLP
PSPWGENILDANEEKSACAGKNNVIKQFVGSDDCLYLNVFTKNLNPKKPC
PVMVYIHGGGHCTGSSTLNSYSPDYVLMSDVVLVTINYRLGPLGFLTLQD
KSLNVPGNAGLKDQQLAMKFVKDNISNFGGDPNNCTLFGHSSGATCVSLH
CLAESSRGLFNRALVMSGSPVATESCILDKDYALKLARNLGFDGHSESDA
LEYLEKADVIAMAEAQFNLPCEYVPYTFGPCIEPYGTAFMLHEPISLLKS
AWSNDIDMLVGGTADEGYITESKFESDNYESIIPDLKLKVNDETLKEYAT
RLFYDKLFPTEYEAYKTFNGDQFRWMAMQRFVHSRQNSSGKGRTFFYRFA
VDSPTQNHYRNRWFGLGSKGVVHADELSYLWKNIQGDVPSRDSIEFIMRF
VNLITSFATTGDPNSNVLNLDFNSFNWKPVETPPYKGLNIGETLEFNILG
ESKRLELLEALYKESAIRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDNNCIVQTEYGKVRGFLQMSLVDIPYIRFLGIPYAKPPVGNLRFKSPLP
PSPWGENILDANEEKSACAGKNNVIKQFVGSDDCLYLNVFTKNLNPKKPC
PVMVYIHGGGHCTGSSTLNSYSPDYVLMSDVVLVTINYRLGPLGFLTLQD
KSLNVPGNAGLKDQQLAMKFVKDNISNFGGDPNNCTLFGHSSGATCVSLH
CLAESSRGLFNRALVMSGSPVATESCILDKDYALKLARNLGFDGHSESDA
LEYLEKADVIAMAEAQFNLPCEYVPYTFGPCIEPYGTAFMLHEPISLLKS
AWSNDIDMLVGGTADEGYITESKFESDNYESIIPDLKLKVNDETLKEYAT
RLFYDKLFPTEYEAYKTFNGDQFRWMAMQRFVHSRQNSSGKGRTFFYRFA
VDSPTQNHYRNRWFGLGSKGVVHADELSYLWKNIQGDVPSRDSIEFIMRF
VNLITSFATTGDPNSNVLNLDFNSFNWKPVETPPYKGLNIGETLEFNILG
ESKRLELLEALYKESAIRL


Reference
    Title: Characterization of the insecticide detoxification carboxylesterase Boest1 from Bradysia odoriphaga Yang et Zhang (Diptera:Sciaridae)
    Ding Q, Xu X, Sang Z, Wang R, Ullah F, Gao X, Song D
    Ref: Pest Manag Sci, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer