(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Enterobacterales: NE > Yersiniaceae: NE > Serratia: NE > Serratia sp. ATCC 39006: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MPTLLYLHGFNSSPLSAKATAFKAWLAQQHPEIEMLVPQLPPYSADAAEM MENLVMERAGRPLGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLL GHLGEQRNPYTGEQYVLESRHIYDLKVMQVEPLESPDLLWCLLQSGDEVL DYRQAVAYYTACRQTVESGGNHAFMGFEHFFAPIIDFLGLTTN
Serratia sp. strain ATCC 39006 is a Gram-negative bacterium and a member of the Enterobacteriaceae that produces various bioactive secondary metabolites, including the tripyrrole red pigment prodigiosin and the beta-lactam antibiotic 1-carbapenen-2-em-3-carboxylic acid (a carbapenem). This strain is the only member of the Enterobacteriaceae known to naturally produce gas vesicles, as flotation organelles. Here we present the genome sequence of this strain, which has served as a model for analysis of the biosynthesis and regulation of antibiotic production.