Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9euro-a0a017s0c9

Aspergillus ruber CBS 135680. PAF acetylhydrolase family protein

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Aspergillus ruber CBS 135680
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus ruber: N E > Aspergillus ruber CBS 135680: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KK088460
1 UniProt : A0A017S0C9
1 UniProt : A0A017S0C9
1 Interpro : A0A017S0C9
1 Pfam : A0A017S0C9
1 PIRSF : A0A017S0C9
1 SUPERFAM : A0A017S0C9
Sequence
Graphical view for this peptide sequence: 9euro-a0a017s0c9
Colored MSA for PAF-Acetylhydrolase (raw)
IALLLCALFHLVHSKILLPGPSGPCQVQIKSTELIDHSRVDPYSPTHDAR
AIMVSAFAPVNCGELQYTPYIPPRIFPEASQKMKLPNSTLNVFDLPSFAP
SEHQNTTKEYPVILFSPGMGSSRLIYANLLEEIASAGYLVISIDHPHDAA
AVEFPDGHVIPMNPSIPHNVSLALQTRVGDVVFTLNQLQHKTQSITPPSF
SSSLHLNHVSIVGHSEGGATAAATMLNDMRFAGGVNLDGSLFGPVVHKGL
DRPFINIGDPHLAKEQKWAWDVIWERLRGYRLQLRINDIKHLGFTDLPLV
FDSAPNAKVLRNESAEHLGSLPGLGTLPGLRVRTILAEYITAACEFFVTG
EKAGLLNRASPVYPEVVYV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IALLLCALFHLVHSKILLPGPSGPCQVQIKSTELIDHSRVDPYSPTHDAR
AIMVSAFAPVNCGELQYTPYIPPRIFPEASQKMKLPNSTLNVFDLPSFAP
SEHQNTTKEYPVILFSPGMGSSRLIYANLLEEIASAGYLVISIDHPHDAA
AVEFPDGHVIPMNPSIPHNVSLALQTRVGDVVFTLNQLQHKTQSITPPSF
SSSLHLNHVSIVGHSEGGATAAATMLNDMRFAGGVNLDGSLFGPVVHKGL
DRPFINIGDPHLAKEQKWAWDVIWERLRGYRLQLRINDIKHLGFTDLPLV
FDSAPNAKVLRNESAEHLGSLPGLGTLPGLRVRTILAEYITAACEFFVTG
EKAGLLNRASPVYPEVVYV


Reference
    Title: Genomic adaptations of the halophilic Dead Sea filamentous fungus Eurotium rubrum
    Kis-Papo T, Weig AR, Riley R, Persoh D, Salamov A, Sun H, Lipzen A, Wasser SP, Rambold G and Nevo E <1 more author(s)>
    Ref: Nat Commun, 5:3745, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer