Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-n9p1u1

Acinetobacter sp. Acinetobacter lwoffii, Uncharacterized protein

Comment
Other strains: Acinetobacter sp. (CIP 64.7; CIP 101966; CIP A162; CIP 51.11; CIP 102136; NIPH 713); Acinetobacter lwoffii (NIPH 715; SH145; CIP 70.31; CIP 70.31; NIPH 512; NIPH 478; NCTC 5866 = CIP 64.10); uncultured bacterium


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Acinetobacter sp. CIP 64.7
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp. CIP 64.7: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9gamm-n9p1u1
Colored MSA for abh_upf00227 (raw)
MNIIYLHGFKSNSNSIKGKLLQHYCAKYPEIQVHLPDLNMSPKAAIAYVS
GLIESMHDVALLGSSLGGFYATHLVAQHAVPAVLINPAMRPWQLFRELFD
EQLPYQVHPKWCLDEADLVQLQQLALPVAQDADKILVLLQQGDEVLDYRE
AHRYYSAAHPPAILMTEAHGSHGMDDFAEKIPFVLQFLLDCIKKETE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNIIYLHGFKSNSNSIKGKLLQHYCAKYPEIQVHLPDLNMSPKAAIAYVS
GLIESMHDVALLGSSLGGFYATHLVAQHAVPAVLINPAMRPWQLFRELFD
EQLPYQVHPKWCLDEADLVQLQQLALPVAQDADKILVLLQQGDEVLDYRE
AHRYYSAAHPPAILMTEAHGSHGMDDFAEKIPFVLQFLLDCIKKETE


Reference
    Title: Fermentation, hydrogen, and sulfur metabolism in multiple uncultivated bacterial phyla
    Wrighton KC, Thomas BC, Sharon I, Miller CS, Castelle CJ, VerBerkmoes NC, Wilkins MJ, Hettich RL, Lipton MS and Banfield JF <2 more author(s)>
    Ref: Science, 337:1661, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer