Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-NcmC

Saccharothrix syringae. NcmC

Comment
Off-loading Dieckmann cyclase, NcmC, that installs the tetramate head group in nocamycin, a hybrid polyketide/nonribosomalpeptide natural product. A conserved thioesterase-like scaffold has been adapted to perform a new chemical reaction: heterocyclization. The catalytic triad for the cyclization reaction consists of Cys89, Asp116, and His254


Relationship
Family|Dieckmann_Cyclase
Block| X
Position in NCBI Life Tree|Saccharothrix syringae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharothrix: N E > Saccharothrix syringae: N E


Molecular evidence
Database
No mutation
3 structures: 6E6T, 6E6U, 6E6Y
No kinetic





3 substrates: Cerulenin, Cerulenin-hemiaminal, N-acetoacetyl-glycyl-SNAC
1 inhbitor:
6E6T-HVV
2 Genbank : KY287782, WP_033435885
1 UniProt : A0A1X9WEN9
3 Structure : 6E6Y, 6E6T, 6E6U
1 UniProt : A0A1X9WEN9
1 Interpro : A0A1X9WEN9
1 Prodom : A0A1X9WEN9
1 Pfam : A0A1X9WEN9
1 PIRSF : A0A1X9WEN9
1 SUPERFAM : A0A1X9WEN9
Sequence
Graphical view for this peptide sequence: 9pseu-NcmC
Colored MSA for Dieckmann_Cyclase (raw)
MTAPRAWRPIAGGPPAGPLVLAVDFAATGRPEAAFADLVARLDPGTEVWE
SLQPPLGTETGMVAEDYVTRWEEEVRASGRRIGAVLGFCAGSAFAGELAV
RLARSQPRSPRLVVFDPESPTTSTLYYQFRKVVESLAGVLGEQAAREALA
EGTAAADRIGDVEGLGAELVRVFTAAGRAACAAADLDDEFADELTATYRS
FVSYLVAAAAVDHVKCWSGAVAVSSATPTSGLNPLDPAARAALVERELTF
DVHHADLLRDPGVARAVARLLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAPRAWRPIAGGPPAGPLVLAVDFAATGRPEAAFADLVARLDPGTEVWE
SLQPPLGTETGMVAEDYVTRWEEEVRASGRRIGAVLGFCAGSAFAGELAV
RLARSQPRSPRLVVFDPESPTTSTLYYQFRKVVESLAGVLGEQAAREALA
EGTAAADRIGDVEGLGAELVRVFTAAGRAACAAADLDDEFADELTATYRS
FVSYLVAAAAVDHVKCWSGAVAVSSATPTSGLNPLDPAARAALVERELTF
DVHHADLLRDPGVARAVARLLA


Reference
    Title: Structural Basis for Enzymatic Off-Loading of Hybrid Polyketides by Dieckmann Condensation
    Cogan DP, Ly J, Nair SK
    Ref: ACS Chemical Biology, 15:2783, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer