Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: agrvs-b9jym4

Agrobacterium vitis (Rhizobium vitis) Putative hydrolase Avi_0199 (YP_002548124.1 WP_012654650)

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Agrobacterium vitis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Rhizobium/Agrobacterium group: N E > Agrobacterium: N E > Agrobacterium vitis: N E


Molecular evidence
Database
No mutation
1 structure:
3LLC: Crystal structure of Putative hydrolase (YP_002548124.1) from Agrobacterium vitis S4 at 1.80 A resolution
No kinetic





No Substrate
1 inhbitor:
Tetraethylene-glycol
2 Genbank : NC_011989, WP_012654650
1 UniProt : B9JYM4
1 Ncbi-nid : 222147015
1 Ncbi-pid : 222147167
1 Structure : 3LLC
1 UniProt : B9JYM4
1 Interpro : B9JYM4
1 Prodom : B9JYM4
1 Pfam : B9JYM4
1 PIRSF : B9JYM4
1 SUPERFAM : B9JYM4
Sequence
Graphical view for this peptide sequence: agrvs-b9jym4
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MTNVGRPIETHAITVGQGSDARSIAALVRAPAQDERPTCIWLGGYRSDMT
GTKALEMDDLAASLGVGAIRFDYSGHGASGGAFRDGTISRWLEEALAVLD
HFKPEKAILVGSSMGGWIALRLIQELKARHDNPTQVSGMVLIAPAPDFTS
DLIEPLLGDRERAELAENGYFEEVSEYSPEPNIFTRALMEDGRANRVMAG
MIDTGCPVHILQGMADPDVPYQHALKLVEHLPADDVVLTLVRDGDHRLSR
PQDIDRMRNAIRAMIEPRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTNVGRPIETHAITVGQGSDARSIAALVRAPAQDERPTCIWLGGYRSDMT
GTKALEMDDLAASLGVGAIRFDYSGHGASGGAFRDGTISRWLEEALAVLD
HFKPEKAILVGSSMGGWIALRLIQELKARHDNPTQVSGMVLIAPAPDFTS
DLIEPLLGDRERAELAENGYFEEVSEYSPEPNIFTRALMEDGRANRVMAG
MIDTGCPVHILQGMADPDVPYQHALKLVEHLPADDVVLTLVRDGDHRLSR
PQDIDRMRNAIRAMIEPRP


Reference
    Title: Identification of lipases with activity towards monoacylglycerol by criterion of conserved cap architectures
    Riegler-Berket L, Leitmeier A, Aschauer P, Dreveny I, Oberer M
    Ref: Biochimica & Biophysica Acta, 1863:679, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer