Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: alceu-tfe2

Alcaligenes eutrophus (Ralstonia eutropha) ( and strain JMP134)(dlh II)

Comment
(TfdEI and TfdEII) located on plasmid pJP4 of Cupriavidus necator JMP134


Relationship
Family|Dienelactone_hydrolase
Block| X
Position in NCBI Life Tree|Ralstonia eutropha
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Cupriavidus: N E > Cupriavidus necator: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Dienelactone
No inhibitor
2 Genbank : U16782, AY365053
2 UniProt : P94136, P94136
1 UniProt : P94136
1 Interpro : P94136
1 Prodom : P94136
1 Pfam : P94136
1 PIRSF : P94136
1 SUPERFAM : P94136
Sequence
Graphical view for this peptide sequence: alceu-tfe2
Colored MSA for Dienelactone_hydrolase (raw)
MCHDTAPALFPRTASTGSIDGAICALCYAGATRGPRLLVLPDIYGCNAFY
RGYAAYLAEQGAGEVLLVDPFAAFGELATVTREAAFQRRHRLADRAYVEE
LIDFIDGQRIEGVVGFCLGGLFVFELARQQVVSRLVAYYPFPQGLENRDP
LDVPFDYLPALRSRHTVIVGDDDALLGTQNLQRLQAQARANDAIDLHIMN
GAGHGFLADLESPDTARAAVAKRGLRIGTTTLLGG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCHDTAPALFPRTASTGSIDGAICALCYAGATRGPRLLVLPDIYGCNAFY
RGYAAYLAEQGAGEVLLVDPFAAFGELATVTREAAFQRRHRLADRAYVEE
LIDFIDGQRIEGVVGFCLGGLFVFELARQQVVSRLVAYYPFPQGLENRDP
LDVPFDYLPALRSRHTVIVGDDDALLGTQNLQRLQAQARANDAIDLHIMN
GAGHGFLADLESPDTARAAVAKRGLRIGTTTLLGG


References
    Title: Two structurally different dienelactone hydrolases (TfdEI and TfdEII) from Cupriavidus necator JMP134 plasmid pJP4 catalyse cis- and trans-dienelactones with similar efficiency
    Kumar A, Pillay B, Olaniran AO
    Ref: PLoS ONE, 9:e101801, 2014 : PubMed

            

    Title: Genetic organization of the catabolic plasmid pJP4 from Ralstonia eutropha JMP134 (pJP4) reveals mechanisms of adaptation to chloroaromatic pollutants and evolution of specialized chloroaromatic degradation pathways
    Trefault N, De la Iglesia R, Molina AM, Manzano M, Ledger T, Perez-Pantoja D, Sanchez MA, Stuardo M, Gonzalez B
    Ref: Environ Microbiol, 6:655, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer