Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: apolu-ACHE1

Apolygus lucorum (Plant bug) (Lygocoris lucorum); Lygus hesperus (Western plant bug) Acetylcholinesterase 1

Comment
Ala216Ser substitution of acetylcholinesterase-1 gene associated with chlorpyrifos resistance A0A0H4AC10 is the unmutated sequence. Other strains: Apolygus lucorum (Plant bug); Lygus hesperus (Western plant bug)


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Apolygus lucorum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Prosorrhyncha: N E > Heteroptera: N E > Euheteroptera: N E > Neoheteroptera: N E > Panheteroptera: N E > Cimicomorpha: N E > Cimicoidea: N E > Miridae: N E > Mirinae: N E > Mirini: N E > Apolygus: N E > Apolygus lucorum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 mutation: apolu-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: apolu-ACHE1
Colored MSA for ACHE (raw)
MRWLLVAAVVLGAGASPPDELLIETDKGRVHGTTLAAATGKYVDAWLGIP
YAQKPLGKLRFRHPKPIDKWDHILNATRPPNTCIQIIDTVFGDFPGATMW
NPNTLLSEDCLYLNVIVPKPRPTNAAVMVWIFGGGFYSGSATLEVYDPKT
LASEENVIIVSMQYRVASLGFLFFDSPEVPGNAGLFDQRMALQWVRNNID
SFGGDPNRVTLFGESAGAVSVSLHLLSPLSRELFKQAIMESGSAVAPWAI
ISRNESILRGLRLAEAVGCPHSKSDISAVIECLRKVNATDLVQNEWGTLG
ICEFPFVPIVDGAFVDDLPRRNLANRNFKKTNIIMGSNSEEGYYFIIYYL
TELFRKEENVYVNREEFLQAVRELNPYVNNVARHAIVFEYTDWQNPDDPI
KNRDALDKMVGDYQFTCSVNDFAHTYAESGNNVYMYFFTHRSMNNPWPSW
TGVMHGDEINYIFGEPLNPTKNYQQNEADLSKRIMNYWANFAKTGNPNLR
SNNSWTSTYWPQHTAYGREYITLDINTTASTGRGPRVKQCAFWKKYLPEL
SSMTEQQSTQECPPVASGVARLDSYILAPIFSFFTFLLVLLTSV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRWLLVAAVVLGAGASPPDELLIETDKGRVHGTTLAAATGKYVDAWLGIP
YAQKPLGKLRFRHPKPIDKWDHILNATRPPNTCIQIIDTVFGDFPGATMW
NPNTLLSEDCLYLNVIVPKPRPTNAAVMVWIFGGGFYSGSATLEVYDPKT
LASEENVIIVSMQYRVASLGFLFFDSPEVPGNAGLFDQRMALQWVRNNID
SFGGDPNRVTLFGESAGAVSVSLHLLSPLSRELFKQAIMESGSAVAPWAI
ISRNESILRGLRLAEAVGCPHSKSDISAVIECLRKVNATDLVQNEWGTLG
ICEFPFVPIVDGAFVDDLPRRNLANRNFKKTNIIMGSNSEEGYYFIIYYL
TELFRKEENVYVNREEFLQAVRELNPYVNNVARHAIVFEYTDWQNPDDPI
KNRDALDKMVGDYQFTCSVNDFAHTYAESGNNVYMYFFTHRSMNNPWPSW
TGVMHGDEINYIFGEPLNPTKNYQQNEADLSKRIMNYWANFAKTGNPNLR
SNNSWTSTYWPQHTAYGREYITLDINTTASTGRGPRVKQCAFWKKYLPEL
SSMTEQQSTQECPPVASGVARLDSYILAPIFSFFTFLLVLLTSV


References
    Title: Genetic analysis and molecular detection of resistance to chlorpyrifos mediated by the A216S substitution in acetylcholinesterase-1 in the plant bug Apolygus lucorum
    Zuo KR, Yang YH, Wu YD, Wu SW
    Ref: Insect Sci, 27:1224, 2020 : PubMed

            

    Title: Survey of organophosphate resistance and an Ala216Ser substitution of acetylcholinesterase-1 gene associated with chlorpyrifos resistance in Apolygus lucorum (Meyer-Dur) collected from the transgenic Bt cotton fields in China
    Zhen C, Miao L, Liang P, Gao X
    Ref: Pestic Biochem Physiol, 132:29, 2016 : PubMed

            

    Title: A point mutation in the acetylcholinesterase-1 gene is associated with chlorpyrifos resistance in the plant bug Apolygus lucorum
    Wu S, Zuo K, Kang Z, Yang Y, Oakeshott JG, Wu Y
    Ref: Insect Biochemistry & Molecular Biology, 65:75, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer