Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: artat-a1r1x6

Arthrobacter aurescens (strain TC1) Uncharacterized protein

Comment
only n-term Pfam A Cutinase 106 287


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Arthrobacter aurescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Micrococcaceae: N E > Paenarthrobacter: N E > Paenarthrobacter aurescens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000474
1 UniProt : A1R1X6
1 UniProt : A1R1X6
1 Interpro : A1R1X6
1 Pfam : A1R1X6
1 PIRSF : A1R1X6
1 SUPERFAM : A1R1X6
Sequence
Graphical view for this peptide sequence: artat-a1r1x6
Colored MSA for Cutinase (raw)
MNNRLSHLLIKLLAFVSCVLLTVVLAGLGVLSPREAEAAPAPGVTCHPLS
ILAFRGSGEKNIDSSVKDPAGSSHDYGDGVVTNGWEGQTLSRLVVSYIRQ
LKTMAGNGVAPSAVPIYGVGPTNDNELGYSAVNALTEAYLNVMNSALDGT
DTALKLADTLRAQAKIDGCPAPKFILIGYSQGAQSARHFAGHSDVVGVLN
LGDPEQSPFAVGNQGTGAKGEGAMRFKYPGLKSVFDIYDSNTQVDKIALC
HKLDPICDFELKHLGNLFTAEQHTNYFLEPAETDEYGRKLAEMVSKHYTA
ASTAKPEASRVGLDTMIAIDTTSSMTPYLKAAIASADAIAQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNNRLSHLLIKLLAFVSCVLLTVVLAGLGVLSPREAEAAPAPGVTCHPLS
ILAFRGSGEKNIDSSVKDPAGSSHDYGDGVVTNGWEGQTLSRLVVSYIRQ
LKTMAGNGVAPSAVPIYGVGPTNDNELGYSAVNALTEAYLNVMNSALDGT
DTALKLADTLRAQAKIDGCPAPKFILIGYSQGAQSARHFAGHSDVVGVLN
LGDPEQSPFAVGNQGTGAKGEGAMRFKYPGLKSVFDIYDSNTQVDKIALC
HKLDPICDFELKHLGNLFTAEQHTNYFLEPAETDEYGRKLAEMVSKHYTA
ASTAKPEASRVGLDTMIAIDTTSSMTPYLKAAIASADAIAQR


Reference
    Title: Secrets of soil survival revealed by the genome sequence of Arthrobacter aurescens TC1
    Mongodin EF, Shapir N, Daugherty SC, DeBoy RT, Emerson JB, Shvartzbeyn A, Radune D, Vamathevan J, Riggs F and Sadowsky MJ <4 more author(s)>
    Ref: PLoS Genet, 2:e214, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer