Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: artpp-f0m5g1

Arthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LM 23796 / Sphe3) Putative phosphoribosyltransferase

Comment
only c-term Pfam A Abhydrolase_5 249 408


Relationship
Family|DLH-S
Block| X
Position in NCBI Life Tree|Arthrobacter phenanthrenivorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Micrococcaceae: N E > Pseudarthrobacter: N E > Pseudarthrobacter phenanthrenivorans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002379
1 UniProt : F0M5G1
1 UniProt : F0M5G1
1 Interpro : F0M5G1
1 Pfam : F0M5G1
1 PIRSF : F0M5G1
1 SUPERFAM : F0M5G1
Sequence
Graphical view for this peptide sequence: artpp-f0m5g1
Colored MSA for DLH-S (raw)
GVDQDVEIAVDGVTLHGDLHLPAQCGAVVVFAHGSGSSRHSPRNRYVASV
LQGAGLGTLLLDLLTPAEEVDRGNVFDIALLAQRLIAANHWLTGRDDTAG
CRVGYFGASTGAGAALWAAAEPGAEVDAVVSRGGRPDLAGPRLAAVRAPT
LLLVGGADTQVLALNRQAMDQMTAPVRLEIIPGATHLFEEPGTLTRAATL
AKGWFARYLLPETAPERASEVPS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GVDQDVEIAVDGVTLHGDLHLPAQCGAVVVFAHGSGSSRHSPRNRYVASV
LQGAGLGTLLLDLLTPAEEVDRGNVFDIALLAQRLIAANHWLTGRDDTAG
CRVGYFGASTGAGAALWAAAEPGAEVDAVVSRGGRPDLAGPRLAAVRAPT
LLLVGGADTQVLALNRQAMDQMTAPVRLEIIPGATHLFEEPGTLTRAATL
AKGWFARYLLPETAPERASEVPS


Reference
    Title: Complete genome sequence of Arthrobacter phenanthrenivorans type strain (Sphe3)
    Kallimanis A, LaButti KM, Lapidus A, Clum A, Lykidis A, Mavromatis K, Pagani I, Liolios K, Ivanova N and Drainas C <11 more author(s)>
    Ref: Stand Genomic Sci, 4:123, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer