Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: asptn-q0ci40

Aspergillus terreus (strain NIH 2624 / FGSC A1156). ATEG_06644 AtFaeD

Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Aspergillus terreus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus terreus: N E


Molecular evidence
Database
3 Genbank : CH476602, XP_001215822, EAU33188
1 UniProt : Q0CI40
1 UniProt : Q0CI40
1 Interpro : Q0CI40
1 Prodom : Q0CI40
1 Pfam : Q0CI40
1 PIRSF : Q0CI40
1 SUPERFAM : Q0CI40
Sequence
Graphical view for this peptide sequence: asptn-q0ci40
Colored MSA for FaeC (raw)
MRYSAATLAASAAGLAANVAANSAGCGTTPSLSSGLNSLTVNGQNREYII
QTPDNYDSSTPHKLVIGYHWRDGTMNNVVDGGFYGLSYLAGDVPTIFVAP
QGIDNGWANSNGDDIAFTDAILEAVESSYCIDEERRFATGWSWGGGMSYS
VACSRADVFRAVAVLSGAEISGCDGGSVPIAYFGQHGVSDSVLPIDLGRQ
LRDHFVQVNGCDAASPQEPAAGSGTHTVTDYTGCSDGHPVQWVAFDGDHE
PTPSDAGAQNSFTGGLIWDFFSQF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRYSAATLAASAAGLAANVAANSAGCGTTPSLSSGLNSLTVNGQNREYII
QTPDNYDSSTPHKLVIGYHWRDGTMNNVVDGGFYGLSYLAGDVPTIFVAP
QGIDNGWANSNGDDIAFTDAILEAVESSYCIDEERRFATGWSWGGGMSYS
VACSRADVFRAVAVLSGAEISGCDGGSVPIAYFGQHGVSDSVLPIDLGRQ
LRDHFVQVNGCDAASPQEPAAGSGTHTVTDYTGCSDGHPVQWVAFDGDHE
PTPSDAGAQNSFTGGLIWDFFSQF


Reference
    Title: Characterization of a feruloyl esterase from Aspergillus terreus facilitates the division of fungal enzymes from Carbohydrate Esterase family 1 of the carbohydrate-active enzymes (CAZy) database
    Makela MR, Dilokpimol A, Koskela SM, Kuuskeri J, de Vries RP, Hilden K
    Ref: Microb Biotechnol, 11:869, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer