Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacco-a0a0b5wsq6

Bacillus coagulans highly thermostable carboxyl esterase

Comment
Other strains: Weizmannia coagulans (Bacillus coagulans) DSM 1 = ATCC 7050


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Bacillus coagulans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus coagulans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 5O7G, 5OLU
No kinetic





3 substrates: IPG-acetate, IPG-butyrate, IPG-caprylate
No inhibitor
3 Genbank : WP_029142894, QQS93602, SHF82964
2 UniProt : A0A7T9LR56, A0A8B4BXT1
2 Structure : 5OLU, 5O7G
2 UniProt : A0A7T9LR56, A0A8B4BXT1
2 Interpro : A0A7T9LR56, A0A8B4BXT1
2 Prodom : A0A7T9LR56, A0A8B4BXT1
2 Pfam : A0A7T9LR56, A0A8B4BXT1
2 PIRSF : A0A7T9LR56, A0A8B4BXT1
2 SUPERFAM : A0A7T9LR56, A0A8B4BXT1
Sequence
Graphical view for this peptide sequence: bacco-a0a0b5wsq6
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MAFQELSFQSFNGKDNVKAWIYTPIRKPRGIVQVVHGFGEHSRRYLHMIL
KFNEAGFVVAADDHVGHGKTAYDSGNWGDWGDKGYMTMAEDEHTLRKIVQ
EQYPDLPYFMFGHSMGSMIARGYAATHGAGLSGLILCGTSGRFPNASKLL
PVLKNLIYEGKGQETDLSYLEELMGWMTERIEQPKTPNDWISSDPDIVAD
HANDPFNNFTTPPNIRSLYYFVQMMEIIVGTEWAEKVPVSIPIYNIAGDQ
DPVGQYGEGVYAVSNWLVQTGHHVKTKVYPGHRHEIHNDRDIRDEVEEGI
ISFINGIIVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFQELSFQSFNGKDNVKAWIYTPIRKPRGIVQVVHGFGEHSRRYLHMIL
KFNEAGFVVAADDHVGHGKTAYDSGNWGDWGDKGYMTMAEDEHTLRKIVQ
EQYPDLPYFMFGHSMGSMIARGYAATHGAGLSGLILCGTSGRFPNASKLL
PVLKNLIYEGKGQETDLSYLEELMGWMTERIEQPKTPNDWISSDPDIVAD
HANDPFNNFTTPPNIRSLYYFVQMMEIIVGTEWAEKVPVSIPIYNIAGDQ
DPVGQYGEGVYAVSNWLVQTGHHVKTKVYPGHRHEIHNDRDIRDEVEEGI
ISFINGIIVK


References
    Title: A stereospecific carboxyl esterase from Bacillus coagulans hosting nonlipase activity within a lipase-like fold
    De Vitis V, Nakhnoukh C, Pinto A, Contente ML, Barbiroli A, Milani M, Bolognesi M, Molinari F, Gourlay LJ, Romano D
    Ref: Febs J, 285:903, 2018 : PubMed

            

    Title: Enhanced enantioselectivity of Bacillus coagulans in the hydrolysis of 1,2-O-isopropylidene glycerol esters by thermal knock-out of undesired enzymes
    Romano D, Falcioni F, Mora D, Molinari F, Buthe A, Ansorge-Schumacher M
    Ref: Tetrahedron Asymmetry, 16:841, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer