bacpu-pnbae

 
Bacillus pumilus (Bacillus mesentericus) Bacillus subtilis (strain BSn5) carboxylesterase gene, complete cds

Relationship
Block C
Bacillus pumilus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus pumilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AY692083, CP002468
1 UniProt : Q66M67
1 Ncbi-nid : 51475141
1 Ncbi-pid : 51475142
1 UniProtTrembl : Q66M67
1 Interpro : Q66M67
1 Prodom : Q66M67
1 Pfam : Q66M67
1 PIRSF : Q66M67
1 SUPERFAM : Q66M67
1 QuickSwissBlast : Q66M67
 
Sequence
Graphical view for this peptide sequence: bacpu-pnbae
Colored MSA for Carb_B_Bacteria (raw)
MTHQIVTTQYGKVKGTTENGVHQWKGIPYAKPPVGQWRFKAPEPPEVWED
VLDATAYGPVCPQPSDLLSLSYTELPRQSEDCLFVNVFAPDTPSQNLPVM
VWIHGGAFYLGAGSEPLYDGSKLAAQGEVIVVTLNYRLGPFGFLHLSSFD
EAYSDNLGLLDQVAALKWVRENISAFGGDPDNATVFGESAGGMSIAALLA
MPAAKGLFQKAIMESGASRTMTKEQAASTSAAFLQVLGINEGQLDKLHTV
SAEDLLKAADQLRIAEKENIFQLFFQPALDPKTLPAEPEKAIAEGAASGI
PLLIGTTRDEGYLFFTPDSDVHSQETLDAALEYLLGKPLAEKAADLYPRS
LESQIHMMTDLLFWRPAVAYASAHSHYAPVWMYRFDWHPEKPPYNKTFHA
LELPFVFGNLDGLERMARAEVTDEAKQLSHSIQSAWITFAKTGNPSTEAV
NWPAYHEETRETLILDSEITIENDPESEKRQKLFPSKGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTHQIVTTQYGKVKGTTENGVHQWKGIPYAKPPVGQWRFKAPEPPEVWED
VLDATAYGPVCPQPSDLLSLSYTELPRQSEDCLFVNVFAPDTPSQNLPVM
VWIHGGAFYLGAGSEPLYDGSKLAAQGEVIVVTLNYRLGPFGFLHLSSFD
EAYSDNLGLLDQVAALKWVRENISAFGGDPDNATVFGESAGGMSIAALLA
MPAAKGLFQKAIMESGASRTMTKEQAASTSAAFLQVLGINEGQLDKLHTV
SAEDLLKAADQLRIAEKENIFQLFFQPALDPKTLPAEPEKAIAEGAASGI
PLLIGTTRDEGYLFFTPDSDVHSQETLDAALEYLLGKPLAEKAADLYPRS
LESQIHMMTDLLFWRPAVAYASAHSHYAPVWMYRFDWHPEKPPYNKTFHA
LELPFVFGNLDGLERMARAEVTDEAKQLSHSIQSAWITFAKTGNPSTEAV
NWPAYHEETRETLILDSEITIENDPESEKRQKLFPSKGE

Graphical view for this nucleotide DNA sequence (1513 bp): bacpu-pnbae



References
    Title: Complete genome sequence of Bacillus subtilis BSn5, an endophytic bacterium of Amorphophallus konjac with antimicrobial activity for the plant pathogen Erwinia carotovora subsp. carotovora
    Deng Y, Zhu Y, Wang P, Zhu L, Zheng J, Li R, Ruan L, Peng D, Sun M
    Ref: Journal of Bacteriology, 193:2070, 2011 : PubMed

            

    Title: Development of a versatile cassette for directional genome walking using cassette ligation-mediated PCR and its application in the cloning of complete lipolytic genes from Bacillus species
    Nthangeni MB, Ramagoma F, Tlou MG, Litthauer D
    Ref: J Microbiol Methods, 61:225, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer