Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacpu-q6rsn0

Bacillus pumilus (Bacillus mesentericus), Bacillus licheniformis, Bacillus sp., lipase PBAT hydrolase

Comment
Other strains: Bacillus pumilus (strains SAFR-032; ATCC 7061) (Bacillus mesentericus), Bacillus licheniformis, Bacillus sp. B26


Relationship
Family|Lipase_2
Block| X
Position in NCBI Life Tree|Bacillus pumilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus pumilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
PBAT
No inhibitor
>3 Genbank links 4 more: DQ345448, DQ339137, AY494714
>3 UniProt links 13 more: Q6RSN0, Q2L991, Q2LAN2
1 Ncbi-nid : 1568337
1 Ncbi-pid : 1568338
>3 UniProt links 13 more: Q6RSN0, Q2L991, Q2LAN2
>3 Interpro links 13 more: Q6RSN0, Q2L991, Q2LAN2
>3 Prodom links 13 more: Q6RSN0, Q2L991, Q2LAN2
>3 Pfam links 13 more: Q6RSN0, Q2L991, Q2LAN2
>3 PIRSF links 13 more: Q6RSN0, Q2L991, Q2LAN2
>3 SUPERFAM links 13 more: Q6RSN0, Q2L991, Q2LAN2
Sequence
Graphical view for this peptide sequence: bacpu-q6rsn0
Colored MSA for Lipase_2 (raw)
MKVILFKKRSLQILVALALVIGSMAFIQPKEVKAAEHNPVVMVHGIGGAS
YNFASIKSYLVGQGWDRNQLYAIDFIDKTGNNRNNGPRLSRFVKDVLDKT
GAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTIGGANGLVSSRALPG
TDPNQKILYTSVYSSADLIVVNSLSRLIGAKNVLIHGVGHIGLLTSSQVK
GYIKEGLNGGGQNTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVILFKKRSLQILVALALVIGSMAFIQPKEVKAAEHNPVVMVHGIGGAS
YNFASIKSYLVGQGWDRNQLYAIDFIDKTGNNRNNGPRLSRFVKDVLDKT
GAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTIGGANGLVSSRALPG
TDPNQKILYTSVYSSADLIVVNSLSRLIGAKNVLIHGVGHIGLLTSSQVK
GYIKEGLNGGGQNTN


References
3 more
    Title: Kinetic studies of Gly28:Ser mutant form of Bacillus pumilus lipase: changes in k(cat) and thermal dependence
    Bustos-Jaimes I, Mora-Lugo R, Calcagno ML, Farres A
    Ref: Biochimica & Biophysica Acta, 1804:2222, 2010 : PubMed

            

    Title: Development of a versatile cassette for directional genome walking using cassette ligation-mediated PCR and its application in the cloning of complete lipolytic genes from Bacillus species
    Nthangeni MB, Ramagoma F, Tlou MG, Litthauer D
    Ref: J Microbiol Methods, 61:225, 2005 : PubMed

            

    Title: Over-expression and properties of a purified recombinant Bacillus licheniformis lipase: a comparative report on Bacillus lipases.
    Nthangeni MB, Patterton HG, Van Tonder A, Vergeer WP, Litthauer D
    Ref: Enzyme Microb Technol, 28:705, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer