Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: calja-u3fsr0

Callithrix jacchus (White-tufted-ear marmoset) Neuroligin-1

Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Callithrix jacchus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Platyrrhini: N E > Cebidae: N E > Callitrichinae: N E > Callithrix [genus]: N E > Callithrix [subgenus]: N E > Callithrix jacchus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : GAMS01006500, GAMR01003677, GAMP01005990
1 UniProt : U3FSR0
1 UniProt : U3FSR0
1 Interpro : U3FSR0
1 Pfam : U3FSR0
1 PIRSF : U3FSR0
1 SUPERFAM : U3FSR0
Sequence
Graphical view for this peptide sequence: calja-u3fsr0
Colored MSA for Neuroligin (raw)
MALPRCTWPNYVWRAVMACLVHRGLGTPLTLCMLGCLLQAGHVLSQKLDD
VDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEP
PSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQS
EDCLYLNIYVPTEDDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASY
GNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGG
DPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL
SSWAVSFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPA
RYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIV
DSDDGISASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPE
TRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAW
ADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTG
DPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRA
NKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAF
PTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYK
KDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDLDHECESIHPH
EVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTF
TGGQNNTLPHPHPHPHSHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MALPRCTWPNYVWRAVMACLVHRGLGTPLTLCMLGCLLQAGHVLSQKLDD
VDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEP
PSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQS
EDCLYLNIYVPTEDDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASY
GNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGG
DPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL
SSWAVSFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPA
RYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIV
DSDDGISASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPE
TRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAW
ADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTG
DPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRA
NKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAF
PTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYK
KDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDLDHECESIHPH
EVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTF
TGGQNNTLPHPHPHPHSHSTTRV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer